ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0431 (CLK-1)

protein serine/threonine kinase-1, a gene from Plasmodium falciparum

Compiled localisation
not cytosol and nucleus

Who localised this protein by microscopy?

Agarwal, S., Kern, S., Halbert, J., Przyborski, J. M., Baumeister, S., Dandekar, T., Doerig, C., Pradel, G.
Two nucleus-localized CDK-like kinases with crucial roles for malaria parasite erythrocytic replication are involved in phosphorylation of splicing factor. (2011 May, J Cell Biochem) PubMed / full text
   more detail about this publication

nucleus and not cytosol
  • "Indirect immunofluorescence, Western blot and electron microscopy data confirm that the kinases are primarily localized in the parasite nucleus, and PfCLK-2 is further present in the cytoplasm."
  • Microscopy type: Fixed Light, EM
  • Microscopy method: mouse antibody to epitope, myc tag
  • Strain: 3D7, NF54
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nucleus and not cytosol
  • Other genes localised in this publication: serine/threonine protein kinase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10523

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0431 protein serine/threonine kinase-1
MTELNIIDNNEKHSKYKLYKYCRNYINDFKNKYMMGYSSNLYKNSPNKYYYDTRNNSNNNNNGYYYHNYNNGYQIRNKRN
RSFETVSNSKNKHKISKKYKYNNEPHESFRDYDYKSKPSYSSVKKIYDREQKRYNKMFVESRYNENHKNKYINNYNLSRK
RNYYSYKKKIYTDRRNFDTHFGQGNIIYNNEYYLINDGSSLNKKRLHYAKGSFRSRSRSKNYNTYNLEKSKKMKYSSRHN
IYRYHNGNKNKSISRWEDNYTYKDIYQPSSSLHKYKRRSNFTRDDNSIKSKMYYENKKTDHLYSYEDKYYNKYDDKYDDK
YDDKYDDKYDDKYDDKYDDKYDDKYDDKYDDNYDDKYDYGEEEHRQEYYKKKKISFNNSTNNKSSINYDDVKRELKKRKK
KKYSNESKVYDSLKRDETNHHTNNNSYLNEINKKNSNLSNNYVAVRNKKRDKEYISDSNKSGFSNKGSYYMQKKKLHVDK
YDNDSHNRTISRTSSDNYSRKKYTHKRNRTKTSDTEDKKERKKKKKKKENNESDDEIVHFSWKKGMLLNNAFLVIRKMGD
GTFGRVLLCQHIDNKKYYAVKVVRNIKKYTRSAKIEADILKKIQNDDINNNNIVKYHGKFMYYDHMCLIFEPLGPSLYEI
ITRNNYNGFHIEDIKLYCIEILKALNYLRKMSLTHTDLKPENILLDDPYFEKSLITVRRVTDGKKIQIYRTKSTGIKLID
FGCATFKSDYHGSIINTRQYRAPEVILNLGWDVSSDMWSFGCVLAELYTGSLLFRTHEHMEHLAMMESIIQPIPKNMLYE
ATKTNGSKYVNKDELKLAWPENASSINSIKHVKKCLPLYKIIKHELFCDFLYSILQIDPTLRPSPAELLKHKFLEENYEY
Y

Gene-Specific Links for PF14_0431

General Sub-Cellular Localisation Links