ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0425 (aldolase, pfAldolase)

fructose-bisphosphate aldolase, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm
not nucleus during ring and trophozoite
cytosol during hepatocyte stage day 2 and hepatocyte stage day 4 and merozoite and ring and schizont and trophozoite
periphery during hepatocyte stage day 7

Who localised this protein by microscopy?

Volz, J., Carvalho, T. G., Ralph, S. A., Gilson, P., Thompson, J., Tonkin, C. J., Langer, C., Crabb, B. S., Cowman, A. F.
Potential epigenetic regulatory proteins localise to distinct nuclear sub-compartments in Plasmodium falciparum. (2010 Jan, Int J Parasitol) PubMed / full text
   more detail about this publication

not nucleus

Bhowmick, I. P., Kumar, N., Sharma, S., Coppens, I., Jarori, G. K.
Plasmodium falciparum enolase: stage-specific expression and sub-cellular localization. (2009, Malar J) PubMed / full text
   more detail about this publication

cytosol and not nucleus during ring and trophozoite
  • "The possibility of spill over of cytosolic enolase into the nucleus during the processing of parasite cells could be ruled out by observing the localization of two other proteins, namely aldolase (Figure 2A) and HSP-70 (Figure 2B). Both these proteins were present in the cytoplasmic compartment and no nuclear presence was detected. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol and not nucleus during ring and troph
  • Other genes localised in this publication: enolase, 6-cysteine protein, enolase

Spielmann, T., Fergusen, D. J., Beck, H. P.
etramps, a new Plasmodium falciparum gene family coding for developmentally regulated and highly charged membrane proteins located at the parasite-host cell interface. (2003 Apr, Mol Biol Cell) PubMed / full text
   more detail about this publication

cytoplasm

Daubenberger, C. A., Tisdale, E. J., Curcic, M., Diaz, D., Silvie, O., Mazier, D., Eling, W., Bohrmann, B., Matile, H., Pluschke, G.
The N'-terminal domain of glyceraldehyde-3-phosphate dehydrogenase of the apicomplexan Plasmodium falciparum mediates GTPase Rab2-dependent recruitment to membranes. (2003 Aug, Biol Chem) PubMed / full text
   more detail about this publication

cytosol during hepatocyte stage day 2 and hepatocyte stage day 4 and merozoite and ring and schizont and trophozoite, periphery during hepatocyte stage day 7
  • "During schizogony, pfGAPDH became associated with the periphery of the parasites and eventually accumulated in the apical region of merozoites, while pfAldolase showed no segregation."
  • Microscopy type: fixed Light
  • Microscopy method: monoclonal antibody
  • Strain:
  • Gene model mapping comments: taken directly from 16321976
  • Localisation record: cytosol during ring and trophozoite and schizont and merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: glyceraldehyde-3-phosphate dehydrogenase, rhoptry-associated protein 1
  • "In non-mature liver schizonts (days 2 and 4), both glycolytic enzymes were co-localized in the cytosol (Figure 4, rows 1 and 2). In contrast, in maturing schizonts (day 7), pfGAPDH seemed to be localized at a higher concentration in the periphery of the schizont while pfAldolase remained evenly distributed (Figure 4, row 3)."
  • Microscopy type: fixed Light
  • Microscopy method: monoclonal antibody
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol during liver stage day 2 and liver stage day 4, periphery during liver stage day 7
  • Other genes localised in this publication: glyceraldehyde-3-phosphate dehydrogenase, rhoptry-associated protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10632

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_130860 fructose-bisphosphate aldolase 2
  • PY03709 Fructose-bisphosphate aldolase class-I
  • PVX_118255 fructose 1,6-bisphosphate aldolase, putative
  • PCHAS_131180 fructose-bisphosphate aldolase, putative
  • PKH_126150 fructose-bisphosphate aldolase, putative
  • TGME49_036050 fructose-bisphosphate aldolase, putative
  • NCLIV_050380 Fructose-bisphosphate aldolase (EC 4.1.2.13), related
  • cgd1_3020 fructose-1,6-bisphosphate aldolase
  • Chro.10335 fructose-1,6-bisphosphate aldolase
  • CMU_029810 fructose-1,6-bisphosphate aldolase, putative
  • TP01_0101 fructose-bisphosphate aldolase, putative
  • TA20060 fructose-bisphosphate aldolase 2, putative
  • BBOV_IV000790 fructose-1,6-bisphosphate aldolase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0425 fructose-bisphosphate aldolase
MAHCTEYMNAPKKLPADVAEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFIS
GAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVID
TAKGKPTDLSIHETAWGLARYASICQQNRLVPIVEPEILADGPHSIEVCAVVTQKVLSCVFKALQENGVLLEGALLKPNM
VTAGYECTAKTTTQDVGFLTVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPHPWALTFSYGRALQASVLNTW
QGKKENVAKAREVLLQRAEANSLATYGKYKGGAGGENAGASLYEKKYVY

Gene-Specific Links for PF14_0425

General Sub-Cellular Localisation Links