ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0408 (SRPK2, CLK-2)

serine/threonine protein kinase, putative, a gene from Plasmodium falciparum

Compiled localisation
nucleus during gametocyte and schizont and trophozoite
not cytoplasm during schizont and trophozoite
cytoplasm during gametocyte

Who localised this protein by microscopy?

Agarwal, S., Kern, S., Halbert, J., Przyborski, J. M., Baumeister, S., Dandekar, T., Doerig, C., Pradel, G.
Two nucleus-localized CDK-like kinases with crucial roles for malaria parasite erythrocytic replication are involved in phosphorylation of splicing factor. (2011 May, J Cell Biochem) PubMed / full text
   more detail about this publication

nucleus during gametocyte and schizont and trophozoite, not cytoplasm during schizont and trophozoite, cytoplasm during gametocyte
  • "Indirect immunofluorescence, Western blot and electron microscopy data confirm that the kinases are primarily localized in the parasite nucleus, and PfCLK-2 is further present in the cytoplasm."
  • Microscopy type: Fixed Light, EM
  • Microscopy method: mouse antibody to epitope, myc tag
  • Strain: 3D7, NF54
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: punctate expression within the nuclei and not cytoplasm during trophozoite and schizont, nucleus and cytoplasm during gametocyte
  • Other genes localised in this publication: protein serine/threonine kinase-1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42219

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0408 serine/threonine protein kinase, putative
MSKTEYDILSLVNAVEEFSKYCSEYKKRHLTNYIQSCSVKNQINNNEEVIFKTTLQDFMNKVNMLGNNILQIEKINKCQI
PENILYEKNGNKMIYDPKHYNEDKLNNENILEDKNKRNICEHIKSKINDKNFVQNNDYGKNIKIINNINEQNLLMKDKND
YTNISENLYMRKISTEYTSSDRSSEDNVLLHNINNVLVKYVSGLDYTLNIRRISRKDLIEEIKQFYIIHNNNIQLNDYST
YLSDEVINILKQKKDNIKCLDKNNLFIIEKNVDFYKNNFLPFFYIPCNYLFIKNYCNDNERCLETTYDTNDEKNSTTENS
YILSSPNHMYNTNTNSYNSHSNSIIARNTSSNKCNSPIFGINERNSSPNFGIFNESIKNHKDQYNMDPNYLIMRYNLNEE
VHIKDDRVINSPNNIKSMNDNRYNSPNFNIEHIHINNNDTQINNYDIYDINNMDGKKNNLNSNTSDFYQSISDFYKNNEK
NLICQEQNNNNTYIQKCAFFLNSNETNVLTNNKNHHKSGKNLISLCFDDELSSAITINNDSSLNKAIYNEFNNSEKDIVE
DICNTTNYKDINMEHMNTYQNDERKWMDEYCNGDYNLFRSKQLKKKKELLLSCISYNEKENKYNDQDNMINVEINNDTKV
KNILYDTGNISFDENIGINNHYNTINLKVIYEANKSEYGNNERLNFIKGQIILNKYKVVKVLSKTQFSTTLKCLNLLYKK
VKTDTQVFLPYCHKYMKDDSEITHDKKKNNYDKFVNLNTIKKKKNENYNRQHDIKNNLHDNKHQIINNKKKVEPKYVCLK
VMKNGKQFLDQGLLELMVLNILCNANTNNNLSNKNIIQLYDSFYYKEHLIIVTEYMQSDLYNYFIRKGKLGTLGQLQILT
KNLLEGLAYIHSKNLIHCDLKPENIMINMKKNKKNHEKGKYNKVNQNGVNIYNDTIEPHILNSSNINNSNLEKKNIIAYP
SFDQTFIENKDAQYDNNEKTSNVLYDSDKSYNNNVKNMIDNNLYCNNIKNIDNNSDNNNNNNNNNFPHNNINIYNTKQFD
KIKIIDFNSCIYESDKLEMYIQTRSYRSPEVLLQQNYDRKIDIWSLGCILFEFLTKKILFDYQNIYRFIYSIVSYIGPFP
FYMINNCRIPHIFTKHGLIILKKFTTDNMYENYIKEEQLNQEDDEEIVFNSNDFFRLNKKDNILTKDLLKNKNPNTSTPR
KRNNNNNEIYYDVCYPSDNLLKNNFQISDTLFVDFLSSLLQIDPSKRCNAMEALKHPWLQPNLYKDGL

Gene-Specific Links for PF14_0408

General Sub-Cellular Localisation Links