ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0368 (TPx-1)

thioredoxin peroxidase 1, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during ring and schizont and trophozoite

Who localised this protein by microscopy?

Yano, K., Komaki-Yasuda, K., Kobayashi, T., Takemae, H., Kita, K., Kano, S., Kawazu, S.
Expression of mRNAs and proteins for peroxiredoxins in Plasmodium falciparum erythrocytic stage. (2005 Mar, Parasitol Int) PubMed / full text
   more detail about this publication

cytoplasm during ring and schizont and trophozoite
  • "Immunofluorescence microscopy of P. falciparum erythrocytic-stage parasites revealed that PfTPx-1 was expressed in the parasite cytoplasm during the ring, trophozoite and schizont stages."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCR-3
  • Gene model mapping comments: blast from primers TCT GAA ATG GCA TCA TAT GTA GGA and CGG AAT TCT TAC AAC TTT GAT AAA TAT T
  • Localisation record: cytoplasm during ring and troph and schizont
  • Other genes localised in this publication: 1-cys peroxiredoxin, thioredoxin, putative, thioredoxin peroxidase 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10063

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0368 thioredoxin peroxidase 1
MASYVGREAPYFKAEAVFADNTFGEVNLHDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFKERNVELIGCSVDSKY
THLAWKKTPLTKGGIGNIQHTLISDITKSISRSYNVLFGDSVSLRAFVLIDKQGVVQHLLVNNLAIGRSVEEVLRIIDAV
QHHEQHGDVCPANWKKGKVAMKPSEEGVSEYLSKL

Gene-Specific Links for PF14_0368

General Sub-Cellular Localisation Links