ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0346 (PKG)

cGMP-dependent protein kinase, a gene from Plasmodium falciparum

Compiled localisation
cytosol during merozoite

Who localised this protein by microscopy?

Taylor, H. M., McRobert, L., Grainger, M., Sicard, A., Dluzewski, A. R., Hopp, C. S., Holder, A. A., Baker, D. A.
The malaria parasite cyclic GMP-dependent protein kinase plays a central role in blood-stage schizogony. (2010 Jan, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol during merozoite
  • "The staining pattern observed throughout the merozoite suggests a predominantly cytosolic localisation"
  • Microscopy type: Light
  • Microscopy method: Polyclonal antibody
  • Strain: 3D7
  • Gene model mapping comments: blast from toxoplasma orthologue AF413570, annotation matches
  • Localisation record: cytosol during merozoite
  • Other genes localised in this publication: rhoptry neck protein 4

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11039

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_100820 cGMP-dependent protein kinase
  • PY02304 cGMP-dependent protein kinase-related
  • PVX_084705 cGMP-dependent protein kinase, putative
  • PCHAS_100910 cGMP-dependent protein kinase, putative
  • PKH_131265 cGMP-dependent protein kinase, putative
  • NCLIV_055260 AGC kinase TgPKG1, putative
  • cgd8_750 cyclic nucleotide (cGMP)-dependent protein kinase with 3 cNMP binding domains and a Ser/Thr kinase domain
  • Chro.80094 cGMP-dependent protein kinase
  • CMU_024660 protein kinase domain-containing protein
  • TA04955 cGMP-dependent protein kinase, putative
  • BBOV_I004690 cGMP dependent protein kinase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0346 cGMP-dependent protein kinase
MEEDDNLKKGNERNKKKAIFSNDDFTGEDSLMEDHLELREKLSEDIDMIKTSLKNNLVCSTLNDNEILTLSNYMQFFVFK
SGNLVIKQGEKGSYFFIINSGKFDVYVNDKKVKTMGKGSSFGEAALIHNTQRSATIIAETDGTLWGVQRSTFRATLKQLS
NRNFNENRTFIDSVSVFDMLTEAQKNMITNACVIQNFKSGETIVKQGDYGDVLYILKEGKATVYINDEEIRVLEKGSYFG
ERALLYDEPRSATIIAKEPTACASICRKLLNIVLGNLQVVLFRNIMTEALQQSEIFKQFSGDQLNDLADTAIVRDYPANY
NILHKDKVKSVKYIIVLEGKVELFLDDTSIGILSRGMSFGDQYVLNQKQPFKHTIKSLEVCKIALITETCLADCLGNNNI
DASIDYNNKKSIIKKMYIFRYLTDKQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEIVKNKKRLRTLGKNDY
FGERALLYDEPRTASVISKVNNVECWFVDKSVFLQIIQGPMLAHLEERIKMQDTKVEMDELETERIIGRGTFGTVKLVHH
KPTKIRYALKCVSKRSIINLNQQNNIKLEREITAENDHPFIIRLVRTFKDSKYFYFLTELVTGGELYDAIRKLGLLSKSQ
AQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGCAKKVQGRAYTLVGTPHYMAPEVILGKGYGCTVDIW
ALGICLYEFICGPLPFGNDEEDQLEIFRDILTGQLTFPDYVTDTDSINLMKRLLCRLPQGRIGCSINGFKDIKDHPFFSN
FNWDKLAGRLLDPPLVSKSETYAEDIDIKQIEEEDAEDDEEPLNDEDNWDIDF

Gene-Specific Links for PF14_0346

General Sub-Cellular Localisation Links