ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0201 (Pf113)

surface protein, Pf113, a gene from Plasmodium falciparum

Compiled localisation
merozoite surface during late schizont
nowhere except parasite plasma membrane during intraerythrocytic

Who localised this protein by microscopy?

Obando-Martinez, A. Z., Curtidor, H., Arevalo-Pinzon, G., Vanegas, M., Vizcaino, C., Patarroyo, M. A., Patarroyo, M. E.
Conserved high activity binding peptides are involved in adhesion of two detergent-resistant membrane-associated merozoite proteins to red blood cells during invasion. (2010 May 27, J Med Chem) PubMed / full text
   more detail about this publication

merozoite surface during late schizont, nowhere except parasite plasma membrane during intraerythrocytic
  • "Conversely, Pf113 was only detected on the merozoite surface, and not in other subcellular compartments or in any other intraerythrocytic life-cycle stage (Figure 3, panels J?M)."
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: FCB-2
  • Gene model mapping comments: taken directly from 16203726
  • Localisation record: merozoite surface during late schizont, nowhere except merozoite surface during intraerythrocytic
  • Other genes localised in this publication: cysteine-rich surface protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_40521

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0201 surface protein, Pf113
MKIPFFILHILLLQFLLCLIRCYVHNDVIKFGEENSLKCSQGNLYVLHCEVQCLNGNNEIIHKRCNDDIEKKCNGNNKCI
YFFEYELRKKTQSFRNKNSIEISECVESEQNEVKTSTTCLLSNSFILDEAFIQYFFFIKNKNEEPVICKDGNINIKSALL
HSPFCEIKLKDISEYIRKKCDNNKECLIDPLDVQKNLLNEEDPCYINNSYVSVNVVCNKEEEIGDESTDSSSMEIQDSTS
NEQDENVKGMSSSQEMNSNNDENKNQDNESDDDVNNNNNNNNDDQDEQGNDGDVTSSMNKNEDNKDLEHGSSNDVNNNTD
TLVNNKENKEFVLKEKSSLTSKINKELAHRTALFNKLADNISLLLNKKYDSFEIKDVLEDRYNEMKRDANPDVYYIYLMD
TLDIEKIEDINLEEVKMSLLASLKETMNKIDTIEKKIEEFKNKYISLYNKVKTTMPELFDLNEDLVLLYNDFPFDNGMIS
SDIFFKYNPSENIMDHQEMVKKGSITEDELRIVNDLEPLDNYRRRKRITELRKILVEKLRILYLEKNNLFNTQASCIKSY
CYKNPLNLKTLEVLLKKNYYRLKENKDYDVVSSIIQHLDNVDANKKKKWLTHERILKKLQVLIAEGYKRINEKEKDIDRR
MAVYNALYEKAQSYNLQKLFNDSNDFLKKYAIMGNSFDDGDEVFGSQSSNFNIFDSNNTDQNNEQEQPKQDDQLLNNNND
DVLSESNNENKEKTSDDATHKETQEKSDQEPSQNIQEDNSDEKHAENEENVEQIETDSNVSEEANDENKDNMQTTTDEGT
EELQQNDEDAESLTKENSKSEEQENEDSTDAEAIDKEEVETEEKGKDEQKKDEQKEQDEEEDGEKENKHKSSETTNETVT
DIEENKNEVKGEEHLQGSEQSIEASESSQKDETKETEDKEEYVNANDDESSEEDTTPNETNKTDNGSSFFFAMSNALLVI
LLLLFIEFL

Gene-Specific Links for PF14_0201

General Sub-Cellular Localisation Links