ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0102 (RAP-1 p86, RAP-1 p82, RAP-1 p67, RAP1, RAP-1)

rhoptry-associated protein 1, a gene from Plasmodium falciparum

Compiled localisation
rhoptry during extracellular merozoite and late schizont and merozoite and schizont and segmenter
not microneme during extracellular merozoite and late schizont and schizont and segmenter
during schizont and segmenter
not parasite plasma membrane during merozoite
apical during merozoite and schizont and segmenter
rhoptry bulb during extracellular merozoite and schizont and segmenter
parasitophorous vacuole during invasion and ring
not rhoptry neck during extracellular merozoite

Who localised this protein by microscopy?

Ito, D., Han, E. T., Takeo, S., Thongkukiatkul, A., Otsuki, H., Torii, M., Tsuboi, T.
Plasmodial ortholog of Toxoplasma gondii rhoptry neck protein 3 is localized to the rhoptry body. (2011 Jun, Parasitol Int) PubMed / full text
   more detail about this publication

rhoptry bulb during schizont, parasitophorous vacuole during ring
  • "Schizont and merozoite stage parasites were dual-labeled with antisera against PfRON3_2 and either PfRAP1 (rhoptry body marker), or PfRON2 (rhoptry neck marker), or PfAMA1 (microneme marker), or PfRESA (dense granule marker). οΎ… Ring stage parasites were dual-labeled with antisera against PfRON3_1 and either PfRAP1 (PV marker), PfEXP2 (PVM marker), PfRON2, or PfRON4."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry body during schizont, PV during ring
  • Other genes localised in this publication: conserved Plasmodium protein, unknown function, apical membrane antigen 1, ring-infected erythrocyte surface antigen, rhoptry neck protein 2, exported protein 2

Richard, D., MacRaild, C. A., Riglar, D. T., Chan, J. A., Foley, M., Baum, J., Ralph, S. A., Norton, R. S., Cowman, A. F.
Interaction between Plasmodium falciparum apical membrane antigen 1 and the rhoptry neck protein complex defines a key step in the erythrocyte invasion process of malaria parasites. (2010 May 7, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry bulb and not rhoptry neck during extracellular merozoite
  • "IFAs using the anti-PfRON antibodies reveal staining of the apical tip of free merozoite, in close apposition with the rhoptry bulb markers PfRAP1 and PfRAMA, suggesting a rhoptry neck localisation."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry bulb and not rhoptry neck during free merozoite
  • Other genes localised in this publication: rhoptry neck protein 4, rhoptry neck protein 5, putative, rhoptry-associated membrane antigen

Richard, D., Kats, L. M., Langer, C., Black, C. G., Mitri, K., Boddey, J. A., Cowman, A. F., Coppel, R. L.
Identification of rhoptry trafficking determinants and evidence for a novel sorting mechanism in the malaria parasite Plasmodium falciparum. (2009 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

rhoptry bulb, during schizont, parasitophorous vacuole during invasion
  • "Immunoelectron microscopy demonstrates that truncated RAP1 (10 nm beads) in D10RAP1 parasites is localised in the rhoptry neck, whereas full-length RAP1 in D10 (wild-type) parasites is localised in the rhoptry bulb. PfRON4 (15 nm beads) is localised in the rhoptry neck in both parasite lines."
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry bulb
  • Comment: stage information not found in publication
  • Other genes localised in this publication: rhoptry neck protein 4, serine repeat antigen 5
  • "Amino acids 22-55 of RAP1 are sufficient for targeting GFP to the rhoptries"
  • Microscopy type: Light
  • Microscopy method: GFP tag after 244 and 144 and 65 and 55 amino acids
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during schizont, PV during invasion
  • Other genes localised in this publication: rhoptry neck protein 4, serine repeat antigen 5

Li, X., Chen, H., Oh, S. S., Chishti, A. H.
A Presenilin-like protease associated with Plasmodium falciparum micronemes is involved in erythrocyte invasion. (2008 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during merozoite
  • "Indirect immunofluorescence microscopy using specific antibodies showed PfSPP is co-localized with EBA-175 (a microneme protein), but neither with RAP1 (a rhoptry marker) nor MSP1 (merozoite surface protein) in the P. falciparum (3D7) schizonts."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during merozoite
  • Other genes localised in this publication: signal peptide peptidase, erythrocyte binding antigen-175, merozoite surface protein 1

Thompson, J., Fernandez-Reyes, D., Sharling, L., Moore, S. G., Eling, W. M., Kyes, S. A., Newbold, C. I., Kafatos, F. C., Janse, C. J., Waters, A. P.
Plasmodium cysteine repeat modular proteins 1-4: complex proteins with roles throughout the malaria parasite life cycle. (2007 Jun, Cell Microbiol) PubMed / full text
   more detail about this publication

rhoptry
  • "Merged and individual images of the florescence pattern of parasites stained with the anti-peptide antibodies (red) indicated on the LHS and antiserum detecting the rhoptry protein RAP1 (green)"
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: A4, 3D7, T9/96
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry
  • Other genes localised in this publication: cysteine repeat modular protein 1, cysteine repeat modular protein 2

Baum, J., Richard, D., Healer, J., Rug, M., Krnajski, Z., Gilberger, T. W., Green, J. L., Holder, A. A., Cowman, A. F.
A conserved molecular motor drives cell invasion and gliding motility across malaria life cycle stages and other apicomplexan parasites. (2006 Feb 24, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during schizont

Pearce, J. A., Mills, K., Triglia, T., Cowman, A. F., Anders, R. F.
Characterisation of two novel proteins from the asexual stage of Plasmodium falciparum, H101 and H103. (2005 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during late schizont

Stubbs, J., Simpson, K. M., Triglia, T., Plouffe, D., Tonkin, C. J., Duraisingh, M. T., Maier, A. G., Winzeler, E. A., Cowman, A. F.
Molecular mechanism for switching of P. falciparum invasion pathways into human erythrocytes. (2005 Aug 26, Science) PubMed / full text
   more detail about this publication

rhoptry bulb during extracellular merozoite and segmenter
  • "W2mef-Rh4GFP1/N was used to test colocalization with PfRh1, PfRh2, and RAP1. All proteins localize to the apical pole and show pronounced overlap in segmenting schizonts and free merozoites with the exception of RAP-1, which is localized to the body of the rhoptries."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: W2mef
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry body during segmenting schizonts and free merozoites
  • Other genes localised in this publication: reticulocyte binding protein homologue 4, normocyte binding protein 1,reticulocyte binding protein homologue 1

Thompson, J., Cooke, R. E., Moore, S., Anderson, L. F., Janse, C. J., Waters, A. P.
PTRAMP; a conserved Plasmodium thrombospondin-related apical merozoite protein. (2004 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry and not microneme during extracellular merozoite and schizont and segmenter
  • "PTRAMP is a merozoite surface protein that originates in the micronemes. Immunofluorescence assays were performed on fixed smears of mixed stage parasites using affinity purified PTRAMP antisera in conjunction with sera detecting the microneme protein AMA-1 or the rhoptry protein RAP1"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: IT0/A4
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry and not microneme during schizont and segmenter
  • Other genes localised in this publication: thrombospondin-related apical membrane protein, apical membrane antigen 1, thrombospondin-related apical membrane protein

Daubenberger, C. A., Tisdale, E. J., Curcic, M., Diaz, D., Silvie, O., Mazier, D., Eling, W., Bohrmann, B., Matile, H., Pluschke, G.
The N'-terminal domain of glyceraldehyde-3-phosphate dehydrogenase of the apicomplexan Plasmodium falciparum mediates GTPase Rab2-dependent recruitment to membranes. (2003 Aug, Biol Chem) PubMed / full text
   more detail about this publication

apical during merozoite
  • "Figure 3B, row 2, results obtained with anti-pfGAPDH (green) and anti-RAP-1 mAbs (red) demonstrate that pf-GAPDH was preferentially co-localized with RAP-1 which is associated with the apical complex of the merozoites (Clark et al., 1987)."
  • Microscopy type: fixed Light
  • Microscopy method: monoclonal antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical during merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: glyceraldehyde-3-phosphate dehydrogenase, fructose-bisphosphate aldolase

Blair, P. L., Kappe, S. H., Maciel, J. E., Balu, B., Adams, J. H.
Plasmodium falciparum MAEBL is a unique member of the ebl family. (2002 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry and not microneme during extracellular merozoite and late schizont

Triglia, T., Thompson, J., Caruana, S. R., Delorenzi, M., Speed, T., Cowman, A. F.
Identification of proteins from Plasmodium falciparum that are homologous to reticulocyte binding proteins in Plasmodium vivax. (2001 Feb, Infect Immun) PubMed / full text
   more detail about this publication

rhoptry bulb during extracellular merozoite

Adams, J. H., Blair, P. L., Kaneko, O., Peterson, D. S.
An expanding ebl family of Plasmodium falciparum. (2001 Jun, Trends Parasitol) PubMed / full text
   more detail about this publication

rhoptry during segmenter
  • "Despite the apparent complete colocalization of EBL-1-specific antibodies with RAP1 and partial colocalization with BAEBL antibodies, the differentiation between micronemes and rhoptries is not possible by confocal microscopy because of its limited resolution."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during fully mature schizont
  • Comment: strain information not found
  • Other genes localised in this publication: A common gene for all genes not assigned to a gene model, erythrocyte binding antigen-140

Howard, R. F., Narum, D. L., Blackman, M., Thurman, J.
Analysis of the processing of Plasmodium falciparum rhoptry-associated protein 1 and localization of Pr86 to schizont rhoptries and p67 to free merozoites. (1998 Apr 1, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during merozoite and schizont, during segmenter, not parasite plasma membrane during merozoite
  • "Panel (a), schizonts stained with antibody 1E8 reveal many examples of paired organellar antibody localization indicating that the Pr86 epitope is present in the rhoptries. In the artists reproduction of IFA images in this panel, six of the many pairs of rhoptries are boxed. Panel (b), merozoites in segmenter-stage schizonts stained with antibody 1E8. Individual nuclei are weakly stained, and there are few, if any, examples of punctate rhoptry staining in intracellular merozoites at this late stage of schizogony."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: FCB-1
  • Gene model mapping comments: Taken directly from 17553576
  • Localisation record: Rhoptries during schizont, weak during segmenter
  • Comment: different cleavage products have different localisations
  • Other genes localised in this publication: apical membrane antigen 1
  • "Neither p67 nor p82 were relocalized from the intracellular rhoptries to the merozoite surface under conditions that promoted relocalization of the rhoptry protein PF83/apical membrane antigen 1."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: FCB-1
  • Gene model mapping comments: Taken directly from 17553576
  • Localisation record: rhoptry and not surface during merozoite
  • Comment: different cleavage products have different localisations
  • Other genes localised in this publication: apical membrane antigen 1

Mohrle, J. J., Zhao, Y., Wernli, B., Franklin, R. M., Kappes, B.
Molecular cloning, characterization and localization of PfPK4, an eIF-2alpha kinase-related enzyme from the malarial parasite Plasmodium falciparum. (1997 Dec 1, Biochem J) PubMed / full text
   more detail about this publication

apical during schizont and segmenter
  • "As observed by immunoelectron microscopy, RAP-1 is localized within the body of the rhoptry [43,52; PF83/AMA-1 is localized more anteriorally within the rhoptry neck [43. PfPK4 does not co-localize with RAP-1."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: K1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical during segmenter and schizont
  • Other genes localised in this publication: protein kinase PK4, apical membrane antigen 1

Bushell, G. R., Ingram, L. T., Fardoulys, C. A., Cooper, J. A.
An antigenic complex in the rhoptries of Plasmodium falciparum. (1988 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during extracellular merozoite and late schizont
  • "Electron microscopic examination of thin sections of parasites immunolabeled with these monoclonal antibodies and colloidal gold anti-mouse conjugate has confirmed that this antigen is localised in the rhoptry organelles of mature schizonts and free merozoites."
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during mature schizont and free merozoite
  • Comment: designation that this protein is RAP1 taken from 17553576
  • Comment: strain information not found
  • Other genes localised in this publication: rhoptry-associated protein 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42838

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0102 rhoptry-associated protein 1
MSFYLGSLVIIFHVLFRNVADGINVNGDNNYGKTIINNDFNFDDYNYWTPINKKEFLNSYEDKFSSESFLENKSSVDDGN
INLTDTSTSNKSSKKGHGRSRVRSASAAAILEEDDSKDDMEFKASPSVVKTSTPSGTQTSGLKSSSPSSTKSSSPSNVKS
ASPHGESNSSEESTTKSSKRSASVAGIVGADEEAPPAPKNTLTPLEELYPTNVNLFNYKYSLNNMEENINILKNEGDLVA
QKEEFEYDENMEKAKQDKKKALEKIGKESDEEPFMFSENKFLENQVKERNVAGSFSRFFSKLNPFKKDEVIEKTEVSKKT
FSGIGFNLTEKEAKVLGVGVTYQEYPETMLYNCPNNSNLFDTIESLQGRVIDIKKRESMISTTFEQQKECLKNMGVLDLE
LNDTQCKFGTCIGSFGEHHLRLYEFENDLLKFHPNIDYLTLADGYKLQKNDIYELSHVNFCLLNPKTLEEFLKKKEIKDL
MGGDDLIKYKENFDNFMSISITCHIESLIYDDIEASQDIAAVLKIAKSKLHVITSGLSYKARKLVYKIYSEIQKNPDELY
EKLTWIYDNIYMIKRYYTAYALEGVCSYLEHDKSQMYTELHIYNKIVDSVRYYSSCFKNVIVYNAIISGIHEKIKHFLKL
VPRHNFLLDYHFNSIFEKEIKPAKKYSTSHIYFDPTVASYAYYNLDRRTMVTIINDYFEAKKKELTVIVSRMKTDMLSLQ
NEESKIPNDKSANSKLATRLMKKFKAEIRDFFKEMRIQYAKLINIRYRSHLKKNYFAFKRLD

Gene-Specific Links for PF14_0102

General Sub-Cellular Localisation Links