ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0078 (HAP)

plasmepsin III,histo-aspartic protease, a gene from Plasmodium falciparum

Compiled localisation
food vacuole during trophozoite

Who localised this protein by microscopy?

Banerjee, R., Liu, J., Beatty, W., Pelosof, L., Klemba, M., Goldberg, D. E.
Four plasmepsins are active in the Plasmodium falciparum food vacuole, including a protease with an active-site histidine. (2002 Jan 22, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

food vacuole during trophozoite
  • "PM II, PM IV, and HAP colocalized with hemozoin in the FV, similar to results reported for PM I (11). Immunoelectron microscopy confirmed that PM I, II, and IV and HAP are in the FV (Fig. 1 B). Gold labeling was found exclusively within the FV. "
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: HB3
  • Gene model mapping comments: Blast from AJ009990, inconsistent 3' UTR
  • Localisation record: FV during trophozoite
  • Other genes localised in this publication: plasmepsin I, plasmepsin II, plasmepsin IV, plasmepsin V, plasmepsin IX, plasmepsin X
  • "Immunoelectron microscopy confirmed that PM I, II, and IV and HAP are in the FV (Fig. 1 B). Gold labeling was found exclusively within the FV. "
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: HB3
  • Gene model mapping comments: Blast from AJ009990, annotation matches
  • Localisation record: FV during troph
  • Other genes localised in this publication: plasmepsin I, plasmepsin II, plasmepsin IV, plasmepsin V, plasmepsin IX, plasmepsin X

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PF14_0078 plasmepsin III,histo-aspartic protease
MNLTIKEEDFTNTFMKNEESFNTFRVTKVKRWNAKRLFKILFVTVFIVLAGGFSYYIFENFVFQKNRKINHIIKTSKYST
VGFNIENSYDRLMKTIKEHKLKNYIKESVKLFNKGLTKKSYLGSEFDNVELKDLANVLSFGEAKLGDNGQKFNFLFHTAS
SNVWVPSIKCTSESCESKNHYDSSKSKTYEKDDTPVKLTSKAGTISGIFSKDLVTIGKLSVPYKFIEMTEIVGFEPFYSE
SDVDGVFGLGWKDLSIGSIDPYIVELKTQNKIEQAVYSIYLPPENKNKGYLTIGGIEERFFDGPLNYEKLNHDLMWQVDL
DVHFGNVSSKKANVILDSATSVITVPTEFFNQFVESASVFKVPFLSLYVTTCGNTKLPTLEYRSPNKVYTLEPKQYLEPL
ENIFSALCMLNIVPIDLEKNTFVLGDPFMRKYFTVYDYDNHTVGFALAKNL

Gene-Specific Links for PF14_0078

General Sub-Cellular Localisation Links