ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0077 (PM II, PM2, PMII, Plasmepsin II)

plasmepsin II, a gene from Plasmodium falciparum

Compiled localisation
cytostome and endoplasmic reticulum during trophozoite
food vacuole during late intraerythrocytic and trophozoite

Who localised this protein by microscopy?

Klemba, M., Beatty, W., Gluzman, I., Goldberg, D. E.
Trafficking of plasmepsin II to the food vacuole of the malaria parasite Plasmodium falciparum. (2004 Jan 5, J Cell Biol) PubMed / full text
   more detail about this publication

cytostome and endoplasmic reticulum during trophozoite, food vacuole during late intraerythrocytic and trophozoite
  • "(C) Immunoelectron micrograph illustrating labeling of the food vacuole of a B7 trophozoite with affinity-purified antiPM II."
  • Microscopy type: Light, EM
  • Microscopy method: GFP
  • Strain: B7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER and cytostomal vacuole and FV during troph, FV during mature intraerythrocytic
  • Other genes localised in this publication: -

Banerjee, R., Liu, J., Beatty, W., Pelosof, L., Klemba, M., Goldberg, D. E.
Four plasmepsins are active in the Plasmodium falciparum food vacuole, including a protease with an active-site histidine. (2002 Jan 22, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

food vacuole during trophozoite
  • "PM II, PM IV, and HAP colocalized with hemozoin in the FV, similar to results reported for PM I (11). Immunoelectron microscopy confirmed that PM I, II, and IV and HAP are in the FV (Fig. 1 B). Gold labeling was found exclusively within the FV. "
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: HB3
  • Gene model mapping comments: Blast from AY878729, inconsistent 5' UTR
  • Localisation record: FV during trophozoite
  • Other genes localised in this publication: plasmepsin I, plasmepsin III,histo-aspartic protease, plasmepsin IV, plasmepsin V, plasmepsin IX, plasmepsin X

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10470

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0077 plasmepsin II
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYENVWLQRDNEMNEILKNSEHL
TIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG
SANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT
ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEERFYEGPLTYEKLNHDLYWQIT
LDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDVIKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQH
IEDVGPGLCMLNIIGLDFPVPTFILGDPFMRKYFTVFDYDNQSVGIALAKKNL

Gene-Specific Links for PF14_0077

General Sub-Cellular Localisation Links