ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0076 (FAF-2, aspartic hemoglobinase I, PMI, PM1, Plasmepsin I, PM I)

plasmepsin I, a gene from Plasmodium falciparum

Compiled localisation
food vacuole during ring and trophozoite
during trophozoite

Who localised this protein by microscopy?

Akompong, T., Kadekoppala, M., Harrison, T., Oksman, A., Goldberg, D. E., Fujioka, H., Samuel, B. U., Sullivan, D., Haldar, K.
Trans expression of a Plasmodium falciparum histidine-rich protein II (HRPII) reveals sorting of soluble proteins in the periphery of the host erythrocyte and disrupts transport to the malarial food vacuole. (2002 Aug 9, J Biol Chem) PubMed / full text
   more detail about this publication

food vacuole during ring and trophozoite
  • "They also show decreased transport of resident fv enzyme PfPlasmepsin I, the endoplasmic reticulum (ER) marker PfBiP, and parasite-associated HRPII to fvs."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 3D7, E8
  • Gene model mapping comments: inferred from another publication
  • Localisation record: FV during ring and troph
  • Other genes localised in this publication: histidine-rich protein II, heat shock protein 70, ER lumen protein retaining receptor

Banerjee, R., Liu, J., Beatty, W., Pelosof, L., Klemba, M., Goldberg, D. E.
Four plasmepsins are active in the Plasmodium falciparum food vacuole, including a protease with an active-site histidine. (2002 Jan 22, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

food vacuole during trophozoite
  • "PM II, PM IV, and HAP colocalized with hemozoin in the FV, similar to results reported for PM I (11). Immunoelectron microscopy confirmed that PM I, II, and IV and HAP are in the FV (Fig. 1 B). Gold labeling was found exclusively within the FV. "
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: HB3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: FV during trophozoite
  • Other genes localised in this publication: plasmepsin II, plasmepsin III,histo-aspartic protease, plasmepsin IV, plasmepsin V, plasmepsin IX, plasmepsin X

Francis, S. E., Gluzman, I. Y., Oksman, A., Knickerbocker, A., Mueller, R., Bryant, M. L., Sherman, D. R., Russell, D. G., Goldberg, D. E.
Molecular characterization and inhibition of a Plasmodium falciparum aspartic hemoglobinase. (1994 Jan 15, EMBO J) PubMed / full text
   more detail about this publication

during trophozoite
  • "Immunolocalization studies place the enzyme in the digestive vacuole and throughout the hemoglobin ingestion pathway, suggesting an unusual protein targeting route."
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: HB3
  • Gene model mapping comments: Blast from X75787.1, inconsistent 5' and 3' UTR
  • Localisation record: during troph
  • Comment: protein named PMI by 14709539
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10470

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0076 plasmepsin I
MALSIKEDFSSAFAKNESAVNSSTFNNNMKTWKIQKRFQILYVFFFLLITGALFYYLIDNVLFPKNKKINEIMNTSKHVI
IGFSIENSHDRIMKTVKQHRLKNYIKESLKFFKTGLTQKPHLGNAGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGS
ANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTL
GQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDL
DLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQI
FDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL

Gene-Specific Links for PF14_0076

General Sub-Cellular Localisation Links