ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0075 (PM IV, PM4)

plasmepsin IV, a gene from Plasmodium falciparum

Compiled localisation
food vacuole during trophozoite

Who localised this protein by microscopy?

Banerjee, R., Liu, J., Beatty, W., Pelosof, L., Klemba, M., Goldberg, D. E.
Four plasmepsins are active in the Plasmodium falciparum food vacuole, including a protease with an active-site histidine. (2002 Jan 22, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

food vacuole during trophozoite
  • "PM II, PM IV, and HAP colocalized with hemozoin in the FV, similar to results reported for PM I (11). Immunoelectron microscopy confirmed that PM I, II, and IV and HAP are in the FV (Fig. 1 B). Gold labeling was found exclusively within the FV. "
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: HB3
  • Gene model mapping comments: Blast from AY878735.1, inconsistent 5' UTR
  • Localisation record: FV during trophozoite
  • Other genes localised in this publication: plasmepsin I, plasmepsin II, plasmepsin III,histo-aspartic protease, plasmepsin V, plasmepsin IX, plasmepsin X

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10470

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0075 plasmepsin IV
MALTVKEEEFSNTLIKNASAFDRLKLGNLKNLKIQKKLQFLYLILFVLITGVFFFFLIGNFYSHRKLYQVIKNTKHTTIG
FKIDRPHDKVLSSVLKNKLSTYVKESFKFFKSGYAQKGYLGSENDSIELDDVANLMFYGEGQIGTNKQPFMFIFDTGSAN
LWVPSVNCDSIGCSTKHLYDASASKSYEKDGTKVEISYGSGTVRGYFSKDVISLGDLSLPYKFIEVTDADDLEPIYSGSE
FDGILGLGWKDLSIGSIDPVVVELKKQNKIDNALFTFYLPVHDKHVGYLTIGGIESDFYEGPLTYEKLNHDLYWQIDLDI
HFGKYVMQKANAVVDSGTSTITAPTSFLNKFFRDMNVIKVPFLPLYVTTCDNDDLPTLEFHSRNNKYTLEPEFYMDPLSD
IDPALCMLYILPVDIDDNTFILGDPFMRKYFTVFDYEKESVGFAVAKNL

Gene-Specific Links for PF14_0075

General Sub-Cellular Localisation Links