ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0067 (CCp3)

LCCL domain-containing protein, a gene from Plasmodium falciparum

Compiled localisation
proximal to plasma membrane during mature gametocyte
during gametocyte stage ii and gametocyte stage iii and gametocyte stage iv and gametocyte stage v and not gametocyte stage i and not intraerythrocytic
erythrocyte during gametocyte stage ii
parasite plasma membrane during emerged gametocyte and emerging male gametocyte and female gametocyte
not parasite plasma membrane during male gametocyte
exflagellation centre during gamete
beyond erythrocyte membrane during emerged gametocyte

Who localised this protein by microscopy?

Scholz, S. M., Simon, N., Lavazec, C., Dude, M. A., Templeton, T. J., Pradel, G.
PfCCp proteins of Plasmodium falciparum: gametocyte-specific expression and role in complement-mediated inhibition of exflagellation. (2008 Mar, Int J Parasitol) PubMed / full text
   more detail about this publication

during gametocyte stage ii and gametocyte stage iii and gametocyte stage iv and gametocyte stage v and not gametocyte stage i, erythrocyte during gametocyte stage ii, parasite plasma membrane during emerging male gametocyte and female gametocyte, not parasite plasma membrane during male gametocyte
  • "PfCCp1, PfCCp2 and PfCCp3 are expressed in a punctate pattern, as has been reported ([Delrieu et al., 2001, [Pradel et al., 2004 and [Pradel et al., 2006). No protein expression was detectable in asexual parasites for PfCCp1 through PfCCp4 and PfFNPA (Fig. 1b and Supplementary Fig. S1). With the exception of PfCCp4, which can be detected as early as stage I gametocytes (Fig. 2b), all proteins are initially expressed in stage II gametocytes. At this stage, PfCCp labelling was also found highlighting infected host erythrocytes, although erythrocyte labelling is no longer observed by gametocyte stage III (Fig. 2a). Expression for all six proteins persists during gametocyte maturation. After gametocyte emergence PfCCp1 through PfCCp3, PfCCp5 and PfFNPA revealed a patchy expression pattern on the plasma membrane of macrogametes, while PfCCp4 is still associated homogenously with this membrane (Fig. 2a). PfCCp protein expression decreased in Pfs25-positive zygotes or unfertilized macrogametes by 24 h after emergence (data not shown). While PfCCp labelling can sometimes be observed on the surface of emerging microgametocytes, PfCCp protein is not present on the surface of exflagellating microgametes."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: Blast from NP_701955, annotation matches, taken directly from publication
  • Localisation record: Punctate during stage II gametocyte and stage III gametocyte and stage IV gametocyte and stage V gametocyte, sometimes erythrocyte during stage II gametocyte, not during stage I gametocyte, patchy plasma membrane during macrogamete, sometimes surface during emerging microgametocyte, not surface during microgamete
  • Other genes localised in this publication: LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL domain-containing protein, LCCL-like protein, 25 kDa ookinete surface antigen precursor

Pradel, G.
Proteins of the malaria parasite sexual stages: expression, function and potential for transmission blocking strategies. (2007 Dec, Parasitology) PubMed / full text
   more detail about this publication

exflagellation centre during gamete, beyond erythrocyte membrane and parasite plasma membrane during emerged gametocyte
  • "(D) Exflagellation centre labelled with anti-PfCCp3 antibodies (shown in red). The protein is partly associated with the surface of emerged gametes and partly released extracellularly surrounding the exflagellation centre."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: exflagellation centre during gamete, surface and released extracellularly during emerged gamete
  • Comment: strain information not found
  • Other genes localised in this publication: 6-cysteine protein, LCCL domain-containing protein, alpha tubulin 2, 25 kDa ookinete surface antigen precursor

Pradel, G., Hayton, K., Aravind, L., Iyer, L. M., Abrahamsen, M. S., Bonawitz, A., Mejia, C., Templeton, T. J.
A multidomain adhesion protein family expressed in Plasmodium falciparum is essential for transmission to the mosquito. (2004 Jun 7, J Exp Med) PubMed / full text
   more detail about this publication

proximal to plasma membrane during mature gametocyte, during not intraerythrocytic
  • "For PfCCp1, PfCCp2, and PfCCp3, a punctate rim fluorescence pattern was observed in P. falciparum gametocytes, whereas asexual stage parasites did not show any labeling (Fig. 4 B)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: punctate rim during mature gametocyte, not during asexual
  • Other genes localised in this publication: LCCL domain-containing protein, LCCL domain-containing protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_16110

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PY01071 multidomain scavenger receptor protein PbSR precursor
  • PVX_086080 multidomain scavenger receptor, putative
  • PCHAS_103600 LCCL domain-containing protein CCP3, putative
  • PKH_133990 multidomain scavenger receptor, putative
  • TGME49_063410 scavenger receptor protein SR2
  • TGME49_067410 scavenger receptor protein TgSR1, putative
  • NCLIV_024520 hypothetical protein
  • NCLIV_038770 hypothetical protein
  • cgd2_790 CpCCp3, multidomain extracellular protein with a signal peptide and the following architecture: LH2+LCCL+2xSR+LCCL+pentraxin+2xLCCL
  • Chro.20090 scavenger receptor protein TgSR1 precursor
  • CMU_009600 LCCL domain-containing protein
  • TA09935 hypothetical protein, conserved
  • BBOV_III008930 LCCL domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0067 LCCL domain-containing protein
MIKFKDILIFINIYILILNAYCKEWCKATFEYGKSDYAECISEGDSISRYMIETIPILSKDVDLYSNVSLVLSNGYGSKT
KEIIIGNENDGLLNKIFTVRSDIGNPEYIHIKLNSQNKNWKCKKITVWKDYKYWVFDCIGSLNDKKPESTYFLSGNKIYI
AYVQTGKDIEAATTGTIEIILLGNNKRSNTKVLHEGFSAGGLKKIKFQASDVGELEDIILINNSLNDPWYCDFVKIKSDN
NNKIYIFNVKSWIGAPYDKNVKVNIKSDTIEGTSKDIDCHIRAIDLINTNNINKLLQNKVQIFKVRCPQNCHNSEFAIIE
GSSIHPSSTSICAAAIHDGSISPSGGEIIVTVASELNHYYTIKEKIFNELEALDFSAKADEKNFTFFTYHLDSIDDIISN
VRIVDSFGKLSSLGRLEIRLKNKNSWGTVCVKGPNFEFNDDAAKRACKDLGFPNGIHIKENCANLNGQNYCAGYKYPFAS
SGILCTGHEKDISKCNADDFSHCVDHHDDVIIQCLHYSSNELINDGAIRLVDINGAPSNNGIGRLQIYYHGVFGSVCSEG
WVKEAENIVCHELGYNGLKGNGFSHHSCTDISGENLCGPDTEKINAVNIKCKGDEKLLRNCPHETHDDIYCSHDEDVIVG
CVGGDNNSHGEEQNKKHLINLEKKKFHPKIELTCFDKMLSKSNLSVATTGDVFLASCPEKCDEEVGIVKGTFLYTYDSPI
CKSAIHSGVLPNNIAEDIVLSIAHTHNNFIGTKRNNIESHDFKGTSKSFTISIPTMSLLREERKSNPKSEDEMINKNEID
LTYDHSVFNNKLDHHITSSMKPTFQWIAPTGFVGFNGKENDYIDCTNLPNEKYIRSLSNFTFIVYFTLNGGEGTWRTILS
HSLCEGISISINEDNELIIEQNCNPHLLKSKFKPKFGQTYHISLVFNKINKTLYLYINGKKVITEKNTYNFTLSGDLIIG
RSNQTTKDYFIGNIHLVEIYKYTLSEQEIKESLNSSLSLEYLNMNILEQMSNTKKDKKKNQKNKKGVQKTIDGRDCVTPC
KSKNMINKDLQINTQQINLKCQDNLLSEQFNGKIGSQFLVSCIENCTKSKYFIKGTNNYYTPDSSICKAAIHAGIYKPNM
GNKNNTFVIRIVEGLLEYKSSRGHFGILSKSEKQSQLRSFSVLSENEENIFTCSTDGQFILNLSVGEKRTINCPSNCNII
KDKIYGTNIYSPTSVLCKAAIHSGALSNQGGLVEIIVGTGQEEFKGSTQNNVESFSSNNHSRSITFNKHMEL

Gene-Specific Links for PF14_0067

General Sub-Cellular Localisation Links