ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0065 (GAPM3)

glideosome associated protein with multiple membrane spans 3, putative, a gene from Plasmodium falciparum

Compiled localisation
inner membrane complex and not parasite plasma membrane during schizont

Who localised this protein by microscopy?

Bullen, H. E., Tonkin, C. J., O'Donnell, R. A., Tham, W. H., Papenfuss, A. T., Gould, S., Cowman, A. F., Crabb, B. S., Gilson, P. R.
A novel family of Apicomplexan glideosome-associated proteins with an inner membrane-anchoring role. (2009 Sep 11, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex and not parasite plasma membrane during schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_24492

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0065 glideosome associated protein with multiple membrane spans 3, putative
MWFTTRQDGLDDNCHTNRGPCFQISGFFGTTLRIGFFLEFIALTFLFMSYWSNGGKGLFSYDLKNINDEYRLDQTFRNSI
TLWTGVYLIGAIFIMSFQVLLADDTCWARGYRAGSKILRLASFLDTISATLQFIFYLYISKFYTRKWYVHFNEGGSEWVF
FIFVRLVHAFSCLLYGLAAYLLEVYHDEGAGDLHAYINGVMFVFAGLTEIFVIFCNSGCYSNLLLWLALGAVSLWSYYFE
PEVNHVSPALHETELTNDVEQQVEKFSRYTPYPQDTNQNAYYPA

Gene-Specific Links for PF14_0065

General Sub-Cellular Localisation Links