ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0020 (CK)

choline kinase, a gene from Plasmodium falciparum

Compiled localisation
cytosol and not mitochondrion and not nucleus during intraerythrocytic
cytoplasm during ring and schizont and trophozoite

Who localised this protein by microscopy?

Alberge, B., Gannoun-Zaki, L., Bascunana, C., Tran van Ba, C., Vial, H., Cerdan, R.
Comparison of the cellular and biochemical properties of Plasmodium falciparum choline and ethanolamine kinases. (2010 Jan 1, Biochem J) PubMed / full text
   more detail about this publication

cytoplasm during ring and schizont and trophozoite
  • "Using mice-polyclonal antibodies against recombinant kinases, PfCK and PfEK were shown to be localized within the parasite cytoplasm."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to whole protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: cytoplasm during ring and troph and schizont
  • Other genes localised in this publication: ethanolamine kinase, putative

Choubey, V., Guha, M., Maity, P., Kumar, S., Raghunandan, R., Maulik, P. R., Mitra, K., Halder, U. C., Bandyopadhyay, U.
Molecular characterization and localization of Plasmodium falciparum choline kinase. (2006 Jul, Biochim Biophys Acta) PubMed / full text
   more detail about this publication

cytosol and not mitochondrion and not nucleus during intraerythrocytic
  • "Southern blotting indicates that PfCK is a single copy gene and it is a cytosolic protein as evidenced by Western immunoblotting and confocal microscopy."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: Cytosol and not nucleus and not mitochondria during erythrocytic stage
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11218

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF14_0020 choline kinase
MESKICDPIGLDKNKFRKVEEENEENSKIVENGQMTYNDDLEMFTTIQLNQEIDIRKNPFPLHMINQKNDIPLCAQEFSK
LTDPLYIKKICLEKVHDWSRCNEDDVCVNQILSGLTNQLFEVSIKEDTAIEYRITRRHVLFRIYGKDVDALYNPLSEFEV
YKTMSKYRIAPLLLNTFDGGRIEEWLYGDPLSIDDLKNKSILVGIANVLGKFHTLSRKRHLPEHWDKTPCVFKMMDRWRL
AVSNYKNLDKVTLDINKYIQESHKFLKFIKIYTQIENIANDIVFCHNDLQENNIMNTNKCLRLIDFEYSGYNFLSADIAN
FFIETTIDYSYNAYPFFIINKKNYISYESRILFVTTYLSKYLDDSTAASDQDIIDQFLEAIEVQALGLHLIWAFWSIIRG
YQTKSYNEFDFFLYAKERLKMYDEQKQYLMSKNIIKDYDD

Gene-Specific Links for PF14_0020

General Sub-Cellular Localisation Links