ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF14_0016 (SEP14)

early transcribed membrane protein 14.1, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasmic vesicle during ring and trophozoite
erythrocyte cytosol during schizont

Who localised this protein by microscopy?

Birago, C., Albanesi, V., Silvestrini, F., Picci, L., Pizzi, E., Alano, P., Pace, T., Ponzi, M.
A gene-family encoding small exported proteins is conserved across Plasmodium genus. (2003 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

erythrocyte cytoplasmic vesicle during ring and trophozoite, erythrocyte cytosol during schizont
  • "The three immune sera gave a similar pattern of fluorescence: at the ring and the trophozoite stages vesicle-like structures were detected within the erythrocytic compartment; with the progression of schizogony the specific-fluorescence appeared more diffuse and the association with vesicles less evident."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication, blast from primer AGCTGTTGTGGCTGGGGCTGG and TTATGTTGCTGCCGGATCTAATA
  • Localisation record: Erythrocyte Cytoplasmic Vesicles during ring and troph, erythrocyte cytosol during schizont
  • Other genes localised in this publication: early transcribed membrane protein 11.2, early transcribed membrane protein 4, early transcribed membrane protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_118692

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF14_0016 early transcribed membrane protein 14.1
MKVSNILFFFFAIIAVKLVYPGYVAAGSNNNAGAPTGKKLTDIEKKKRNKNIVLYSSLASALALLVGTGVGLGFYYKNKN
DKGEKEETDGAKPKNTEVKEPAPATTA

Gene-Specific Links for PF14_0016

General Sub-Cellular Localisation Links