ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0353 ()

NADH-cytochrome b5 reductase, putative, a gene from Plasmodium falciparum

Compiled localisation
food vacuole membrane during trophozoite

Who localised this protein by microscopy?

Ostera, G., Tokumasu, F., Oliveira, F., Sa, J., Furuya, T., Teixeira, C., Dvorak, J.
Plasmodium falciparum: food vacuole localization of nitric oxide-derived species in intraerythrocytic stages of the malaria parasite. (2008 Sep, Exp Parasitol) PubMed / full text
   more detail about this publication

food vacuole membrane during trophozoite
  • "We showed that the product of PF13_0353, a molecule that is structurally similar to a plant nitrate reductase, localizes in the membranous system that surrounds the food vacuole."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: food vacuole membrane during trophozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10492

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF13_0353 NADH-cytochrome b5 reductase, putative
MKRSFRSMLRSIFMRILYFLTSNISSIIIFCVSISFLGYFGKELHNNNKLFNLYSKKHEYEELDTKEKSQEKPFLNGKNQ
SFKLYKIIKLTPTVKIFIFSYPDEYEYLGLGICKHIKFNASNIEGKIKGKWNNNDDKEKNLKQISRSYTPVYIDKKKKHV
HFIIRVYYPDDEYIDGGKMSIQLNKLNNNDEIDINGPFGLLEYKGNNELLHLSKSVKIKKHIVMIAGGTGMTPFFRLINH
LLLTKEKELPSDPVYITFIYANRNENEILLKSIFDDYENRFENFKRVYSVDKCLNTNQMGNFENIGFINEELLRKYVLKY
EKLNIEVKNKDTLILLCGPPPMTSSIKSILKDQIHMENIIVF

Gene-Specific Links for PF13_0353

General Sub-Cellular Localisation Links