ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0338 (Pf92)

cysteine-rich surface protein, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during merozoite
merozoite surface during late schizont
during ring

Who localised this protein by microscopy?

Obando-Martinez, A. Z., Curtidor, H., Arevalo-Pinzon, G., Vanegas, M., Vizcaino, C., Patarroyo, M. A., Patarroyo, M. E.
Conserved high activity binding peptides are involved in adhesion of two detergent-resistant membrane-associated merozoite proteins to red blood cells during invasion. (2010 May 27, J Med Chem) PubMed / full text
   more detail about this publication

merozoite surface during late schizont, during ring
  • "The results of immunofluorescence assays with P. falciparum late schizonts localized Pf92 in merozoite surface (Figure 3, panels B?I), which is consistent with the fluorescence pattern reported for the Pf92-GFP fusion protein(8) but also showed the presence of this protein in ring stages (Figure 3, panels C?E)."
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: FCB-2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: merozoite surface during late schizont, during ring
  • Other genes localised in this publication: surface protein, Pf113

Sanders, P. R., Gilson, P. R., Cantin, G. T., Greenbaum, D. C., Nebl, T., Carucci, D. J., McConville, M. J., Schofield, L., Hodder, A. N., Yates, J. R. 3rd, Crabb, B. S.
Distinct protein classes including novel merozoite surface antigens in Raft-like membranes of Plasmodium falciparum. (2005 Dec 2, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "Using the inducible GFP expression system, we also show that another predicted GPI-anchored protein, Pf92, also localizes to the merozoite surface "
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from 16203726
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: 6-cysteine protein, 6-cysteine protein, 6-cysteine protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_84674

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_115165 hypothetical protein, conserved
  • PKH_110660 conserved Plasmodium protein, unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0338 cysteine-rich surface protein
MFAVNLKICIFLSLVSFLLQCKNTLANVTFEQKVQTNLSHDKNGDIVYGHREFKGGIYAFLGYDNCTIEVNKTVNGIDWN
EKKDVKVSGNNNIAVVYSIFTSEEKMILIFKCDNKFYITKYGKEFKWSDPKVIDVSNVIGTNTTPAVYSGSLLSMNNDFE
KYILVCENHSQNYINVVDQEYMREIRLLGKCMLSFDEGNNWKNEVMNLYSDEGYTKINTLRLSDYGGKILVKGTNAQNLN
QTIRSIILLCSNLHDWKLFCGLPTIRFRKDISVENLTYLNTYHLAIVKNEDKLQLAFTYDLFETFDPQYLNTEFNGVSHY
FVLAPDEMVYLFYHGNEKKNYVIKIKTVPRKIGCELNTNDTVNKIYTYTYKYIYNNKLSAKTCKVPSSHLKYSSDGLYKL
FEVRLPKDIKVTENCFRYSFLSDLNNKYHTTIIKTRVINKLEDYVEVQFHFPIYYTKFLYNYKSTYCVLSNNYRIVVEFD
YIRNHIDLDFPFDTDTVKLYSNESVTHAFRNNTEKTHVHKFPKGTYMTSYFSYEKEYVISNYIEEPFSTTFTILTQTQMN
VHFMAGGQKYKYEGIDLTDSSPNYELSLNSLSDSQNVDIFVSKFDNNKTIGFVCPVKSSYDGLNCFDNVYIKNKTLVKIE
YLFGENDIFVVPQRRIYKTEGTAMESLLYLNNNNVKKLIDDKSIIHFYCECNVNNNVIKVNYYISPFYDENSIKQEINKK
DQEITMINKTIPQDEKDILFNNEKVVPLSNEPQEIIQPPIQEKLNTTDPSKAYIYGANIIFIAIISIISLSISSFI

Gene-Specific Links for PF13_0338

General Sub-Cellular Localisation Links