ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0322 (FLN)

falcilysin, a gene from Plasmodium falciparum

Compiled localisation
apicoplast and food vacuole during ring and schizont and segmenter and trophozoite

Who localised this protein by microscopy?

Ponpuak, M., Klemba, M., Park, M., Gluzman, I. Y., Lamppa, G. K., Goldberg, D. E.
A role for falcilysin in transit peptide degradation in the Plasmodium falciparum apicoplast. (2007 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast and food vacuole during ring and schizont and segmenter and trophozoite
  • "Unexpectedly, FLN was found in the apicoplast, an essential chloroplast-like organelle."
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag, polyclonal antibody directly to protein
  • Strain: 3D7, MP3
  • Gene model mapping comments: apicoplast by gfp, old immuno data said FV, but newer gfp shows additional apicoplast. Also 'possible mitochondrial pool' or something
  • Localisation record: Apicoplast and some FV during ring and troph and schizont and segmenter
  • Other genes localised in this publication: acyl carrier protein, heat shock protein 60

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11041

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF13_0322 falcilysin
MNLTKLMKVIGYINIITNCVQSFTNRADKKRYNVFAKSFINTINTNLYTFKAVMSKTPEWIHEKSPKHNSYDIIEKRYNE
EFKMTYTVYQHKKAKTQVISLGTNDPLDVEQAFAFYVKTLTHSGKGIPHILEHSVLSGSKNYNYKNSIGLLEKGTLHTHL
NAYTFNDRTVYMAGSMNNKDFFNIMGVYMDSVFQPNVLENKYIFETEGWTYEVEKLKEDEKGKAEIPQMKDYKVSFNGIV
YNEMKGALSSPLEDLYHEEMKYMFPDNVHSNNSGGDPKEITNLTYEEFKEFYYKNYNPKKVKVFFFSKNNPTELLNFVDQ
YLGQLDYSKYRDDAVESVEYQTYKKGPFYIKKKYGDHSEEKENLVSVAWLLNPKVDKTNNHNNNHSNNQSSENNGYSNGS
HSSDLSLENPTDYFVLLIINNLLIHTPESVLYKALTDCGLGNNVIDRGLNDSLVQYIFSIGLKGIKRNNEKIKNFDKVHY
EVEDVIMNALKKVVKEGFNKSAVEASINNIEFILKEANLKTSKSIDFVFEMTSKLNYNRDPLLIFEFEKYLNIVKNKIKN
EPMYLEKFVEKHFINNAHRSVILLEGDENYAQEQENLEKQELKKRIENFNEQEKEQVIKNFEELSKYKNAEESPEHLNKF
PIISISDLNKKTLEVPVNVYFTNINENNNIMETYNKLKTNEHMLKDNMDVFLKKYVLKNDKHNTNNNNNNNNNMDYSFTE
TKYEGNVPILVYEMPTTGIVYLQFVFSLDHLTVDELAYLNLFKTLILENKTNKRSSEDFVILREKNIGSMSANVALYSKD
DHLNVTDKYNAQALFNLEMHVLSHKCNDALNIALEAVKESDFSNKKKVIDILKRKINGMKTTFSEKGYAILMKYVKAHLN
SKHYAHNIIYGYENYLKLQEQLELAENDFKTLENILVRIRNKIFNKKNLMVSVTSDYGALKHLFVNSNESLKNLVSYFEE
NDKYINDMQNKVNDPTVMGWNEEIKSKKLFDEEKVKKEFFVLPTFVNSVSMSGILFKPGEYLDPSFTVIVAALKNSYLWD
TVRGLNGAYGVFADIEYDGSVVFLSARDPNLEKTLATFRESAKGLRKMADTMTENDLLRYIINTIGTIDKPRRGIELSKL
SFLRLISNESEQDRVEFRKRIMNTKKEDFYKFADLLESKVNEFEKNIVIITTKEKANEYIANVDGEFKKVLIE

Gene-Specific Links for PF13_0322

General Sub-Cellular Localisation Links