ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0280 (ERD2) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

ER lumen protein retaining receptor, a gene from Plasmodium falciparum

Compiled localisation
cis-golgi during early trophozoite and intraerythrocytic and late schizont and late trophozoite and ring and trophozoite
not trans golgi during ring and trophozoite
area around nucleus during late ring and late trophozoite and ring and schizont
golgi apparatus during early intraerythrocytic and intraerythrocytic and ring and schizont and trophozoite
not nucleus
not endoplasmic reticulum during early trophozoite and intraerythrocytic and late schizont and late trophozoite

Who localised this protein by microscopy?

Ayong, L., DaSilva, T., Mauser, J., Allen, C. M., Chakrabarti, D.
Evidence for prenylation-dependent targeting of a Ykt6 SNARE in Plasmodium falciparum. (2011 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

golgi apparatus during trophozoite
  • "The GFP-PfYkt6.1 compartments were only partially labeled with antibodies against the Golgi marker PfErd2 (B), or the ER marker PfBip (C). "
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Golgi during trophozoite
  • Other genes localised in this publication: SNARE protein, putative, heat shock protein 70

Volz, J., Carvalho, T. G., Ralph, S. A., Gilson, P., Thompson, J., Tonkin, C. J., Langer, C., Crabb, B. S., Cowman, A. F.
Potential epigenetic regulatory proteins localise to distinct nuclear sub-compartments in Plasmodium falciparum. (2010 Jan, Int J Parasitol) PubMed / full text
   more detail about this publication

not nucleus

Gratraud, P., Huws, E., Falkard, B., Adjalley, S., Fidock, D. A., Berry, L., Jacobs, W. R. Jr, Baird, M. S., Vial, H., Kremer, L.
Oleic acid biosynthesis in Plasmodium falciparum: characterization of the stearoyl-CoA desaturase and investigation as a potential therapeutic target. (2009, PLoS One) PubMed / full text
   more detail about this publication

cis-golgi and not endoplasmic reticulum during early trophozoite and late schizont and late trophozoite
  • "As shown in Fig. 5B, PfSCD-GFP colocalized mostly with PfBiP and PfDSI (disulfide isomerase), two soluble ER markers [41], [43], therefore confirming the ER localization of PfSCD-GFP."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cis-golgi and not endoplasmic reticulum during early trophozoite and late trophozoite and segmented schizont
  • Other genes localised in this publication: stearoyl-CoA delta 9 desaturase, putative, heat shock protein 70, protein disulfide isomerase, acyl carrier protein

Pendyala, P. R., Ayong, L., Eatrides, J., Schreiber, M., Pham, C., Chakrabarti, R., Fidock, D. A., Allen, C. M., Chakrabarti, D.
Characterization of a PRL protein tyrosine phosphatase from Plasmodium falciparum. (2008 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cis-golgi during intraerythrocytic
  • "To test whether PfPRL indeed is targeted to Golgi, we analyzed its co-localization with the cis-Golgi marker PfERD2."
  • Microscopy type: Light
  • Microscopy method:
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cis golgi during asexual
  • Other genes localised in this publication: protein tyrosine phosphatase, heat shock protein 70, apical membrane antigen 1

Ayong, L., Pagnotti, G., Tobon, A. B., Chakrabarti, D.
Identification of Plasmodium falciparum family of SNAREs. (2007 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cis-golgi during trophozoite
  • ""
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cis golgi during trophozoite
  • Other genes localised in this publication: SNARE protein, syntaxin, Qa-SNARE family, heat shock protein 70

Singh, S., Plassmeyer, M., Gaur, D., Miller, L. H.
Mononeme: a new secretory organelle in Plasmodium falciparum merozoites identified by localization of rhomboid-1 protease. (2007 Dec 11, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

cis-golgi

Charneau, S., Bastos, I. M., Mouray, E., Ribeiro, B. M., Santana, J. M., Grellier, P., Florent, I.
Characterization of PfDYN2, a dynamin-like protein of Plasmodium falciparum expressed in schizonts. (2007 Jun, Microbes Infect) PubMed / full text
   more detail about this publication

golgi apparatus during schizont
  • "Merged images of PfDYN2 (green) and the ER PfBIP (red, df), the apicoplast PfACP (red, gi) and the Golgi apparatus PfERD2 (red, jl)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: FcB1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi apparatus during schizont
  • Other genes localised in this publication: dynamin-like protein, heat shock protein 70, acyl carrier protein

Struck, N. S., de Souza Dias, S., Langer, C., Marti, M., Pearce, J. A., Cowman, A. F., Gilberger, T. W.
Re-defining the Golgi complex in Plasmodium falciparum using the novel Golgi marker PfGRASP. (2005 Dec 1, J Cell Sci) PubMed / full text
   more detail about this publication

cis-golgi during ring
  • "PfGRASP-GFP colocalises with the cis-Golgi marker ERD2."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cis golgi during ring
  • Other genes localised in this publication: golgi re-assembly stacking protein 1, Rab GTPase 6, heat shock protein 70

Seydel, K. B., Gaur, D., Aravind, L., Subramanian, G., Miller, L. H.
Plasmodium falciparum: characterization of a late asexual stage golgi protein containing both ankyrin and DHHC domains. (2005 Aug, Exp Parasitol) PubMed / full text
   more detail about this publication

golgi apparatus during schizont
  • "3D7 schizonts were labeled with (A) rat anti-PfAnkDHHC, and (B) rabbit anti-ERD2, a known Golgi marker."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi during schizont
  • Other genes localised in this publication: palmitoyl transferase

Klemba, M., Goldberg, D. E.
Characterization of plasmepsin V, a membrane-bound aspartic protease homolog in the endoplasmic reticulum of Plasmodium falciparum. (2005 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

golgi apparatus and not endoplasmic reticulum during intraerythrocytic
  • "Extensive colocalization of PM V and BiP was observed (Fig. 5C). In contrast, PM V did not colocalize with the Golgi marker ERD2 (Fig. 5D), which is distributed in small, juxtanuclear foci as previously described"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: HB3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi and not ER during asexual
  • Other genes localised in this publication: plasmepsin V, heat shock protein 70

Topolska, A. E., Lidgett, A., Truman, D., Fujioka, H., Coppel, R. L.
Characterization of a membrane-associated rhoptry protein of Plasmodium falciparum. (2004 Feb 6, J Biol Chem) PubMed / full text
   more detail about this publication

golgi apparatus during early intraerythrocytic
  • "To ascertain RAMA trafficking through the compartments of the secretory pathway, we performed double staining IFA using mouse anti-RAMA-E sera and rabbit antibodies to either ER marker (PfGRP) or Golgi marker (PfERD2) proteins."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi during early intraerythrocytic stages
  • Other genes localised in this publication: rhoptry-associated membrane antigen, heat shock protein 70

Akompong, T., Kadekoppala, M., Harrison, T., Oksman, A., Goldberg, D. E., Fujioka, H., Samuel, B. U., Sullivan, D., Haldar, K.
Trans expression of a Plasmodium falciparum histidine-rich protein II (HRPII) reveals sorting of soluble proteins in the periphery of the host erythrocyte and disrupts transport to the malarial food vacuole. (2002 Aug 9, J Biol Chem) PubMed / full text
   more detail about this publication

golgi apparatus during ring and trophozoite
  • "High resolution-digitized fluorescence microscopy (Fig. 6A) show that HRPII and plasmepsin I show substantial colocalization with PfBiP in E8 cells but not markers of the Golgi (ERD2) or the parasite plasma membrane (not shown), consistent with the idea that HRPII and plasmepsin I are blocked in the ER in E8 cells and could be substrates in an ER to fv pathway."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7, E8
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi during ring and troph
  • Other genes localised in this publication: histidine-rich protein II, plasmepsin I, heat shock protein 70

Van Wye, J., Ghori, N., Webster, P., Mitschler, R. R., Elmendorf, H. G., Haldar, K.
Identification and localization of rab6, separation of rab6 from ERD2 and implications for an 'unstacked' Golgi, in Plasmodium falciparum. (1996 Dec 2, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cis-golgi and not trans golgi during ring and trophozoite
  • "A comparison of Fig. 2A and B, clearly indicates that the dispersed localization of Pfrab6 in multiple sites in the parasite is distinct from that of PfERD2, which is concentrated in one defined region of the cell."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCB
  • Gene model mapping comments: inferred from another publication
  • Localisation record: early golgi and not late golgi during ring and troph
  • Other genes localised in this publication: Rab GTPase 6

Elmendorf, H. G., Haldar, K.
Identification and localization of ERD2 in the malaria parasite Plasmodium falciparum: separation from sites of sphingomyelin synthesis and implications for organization of the Golgi. (1993 Dec, EMBO J) PubMed / full text
   more detail about this publication

area around nucleus during late ring and late trophozoite and ring and schizont
  • "removal of the drug results in recovery of the single focus, consistent with the localization of PfERD2 to the parasite Golgi and its participation in a retrograde transport pathway to the ER."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCR-3/A2
  • Gene model mapping comments: Blast from X74869, gene model inconsistent
  • Localisation record: area around nucleus during ring and late ring and late troph and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10752

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_113020 ER lumen protein retaining receptor, putative
  • PY05552 er lumen protein retaining receptor-related
  • PVX_114670 ER lumen protein retaining receptor, putative
  • PCHAS_112970 ER lumen protein retaining receptor, putative
  • PKH_111750 ER lumen protein retaining receptor, putative
  • TGME49_076910 endoplasmic reticulum retention receptor, putative
  • NCLIV_029080 hypothetical protein
  • NCLIV_068650 endoplasmic reticulum retention receptor, putative
  • cgd8_1110 ER/lumen protein retaining receptor (KDEL receptor), signal peptide plus 4 or more transmembrane domains
  • Chro.80131 endoplasmic reticulum retention receptor
  • CMU_025020 ER lumen protein retaining receptor protein, putative
  • TA11365 endoplasmic reticulum lumen protein retaining receptor (ERD2 homologue), putative
  • BBOV_III009160 ER lumen protein retaining receptor
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF13_0280 ER lumen protein retaining receptor
MNIFRLIGDILHLVSMYILIMKLKKSKNCIGISCRMQELYLIVFLCRYIDLFFVFVSFYNTVMKITFILTIAYTIYLIRL
KLPISQTYNRKVDNFKSEKYLIPPCLVLSLLTCKTYNLYNILWSFSIWLESVAILPQLVLLEKQREVENITSHYVITMGL
YRAFYILNWIYRYFFDDKPYINVVGWIGGLIQTLLYIDFFYYFALAKWYGKKLVLPFNGEV

Gene-Specific Links for PF13_0280

General Sub-Cellular Localisation Links