ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0258 (TKL3)

serine/threonine protein kinase, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and not exported during schizont
microtubule during gametocyte

Who localised this protein by microscopy?

Abdi, A., Eschenlauer, S., Reininger, L., Doerig, C.
SAM domain-dependent activity of PfTKL3, an essential tyrosine kinase-like kinase of the human malaria parasite Plasmodium falciparum. (2010 Oct, Cell Mol Life Sci) PubMed / full text
   more detail about this publication

cytoplasm and not exported during schizont, microtubule during gametocyte
  • "PfTKL3 is expressed in both asexual and gametocytes stages, and in the latter the protein co-localises with cytoskeleton microtubules … In schizonts, the signal seems to be confined within the parasite (implying the putative PEXEL is not functional) and to localise within structures forming a network that becomes extensive in mid and late schizont stages."
  • Microscopy type: Live light, Fixed light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: taken directly from publication
  • Localisation record: cytoplasm and not exported during schizont, cytoskeleton microtubules during gametocyte
  • Other genes localised in this publication: sexual stage-specific protein precursor, alpha tubulin 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25228

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0258 serine/threonine protein kinase
MSEHSSGVSRKLFCNSDKLFYDNFRNLDDRLNLNNNFNENRYEEIYNKKYLRNNRRFKTEPPKHLYENESEQSYSSLFHN
ILRSISKNIRNDEKEESSDNNNCDDDNDNNNDDDDNNNQSDSIPNNSENFNYDDNSCCEISPYDEISKKTKRVHNKIHKN
EDGEYYKNVLYNNNNLSKENQINNICSSINKTQRTLKRIDTNINETLNNVKYIKMVNSDIISDVFLKNNVKSLIVYDTGG
IDIELIENENPEFLYHTYTGNRISNIYYEYDDCIKNKDTYKNEEKKKKKNTFNSSLLYRENYIFKKEHELNYCYKNKDDN
KKKIKNNPSEKNQIMNYSSDICSNSDSKKLFTKNKKQENVINKNIYYNNPSDYNILNNEVNYNKNTVHNTNLSKDTCEHT
YKNVSNKYDIQDHNTNSSAEKYYNMNYKSSLLNKNDKYIENTSSERNKGYRSYSSMSSMLSLNAYEKENRKKYYYIGETI
NNIRNGWGMLIYNDRVIFEGEYKMNNAIGYFIKYNEYSTEIGYRSPISVKSVIIMSDNDNFIVQNRSENLDTSKNKEQKS
GNNSWNVYKYDNDNSDHNDDSDDNGDSDDNGDSDYNNENIYNNENILNNENIYNNENILNNENILNNENILNNENIYNNE
NIYNNENIYNNENIHNNENIHNNENIHNNENIHNNENIHNNENIHNNENIYNHHSNDSSGENIRDSFSKNNIKNISKDTY
KINNNENINNLDKNVPIYDNSSNSINNCSYYINSKYANKSSSNKGNKMISKHSTLKNSSCINNDIKNIKFSENPEENAKE
LKKFNNLTSYVRRNSKHKTSPARSINYLKPPVMNLIRNNIYFNRNTLGKNDKTTFCTSNIHSSNKKMREHKTTHFLSPMN
IIVTSLDTDDEDNISDDNGKTDVISSCTQYEEERKKDEQNIKTEEVQYIETYMKDNDTRVLYELKINKNDDILSNHKTNE
SIFEKKDFKKYEEIYNNDYDHQNIIKTVCSKNDNNIDNVKNMKSVDIYDTNKKNYNRNYMNNLDNANNFDEPTNNTFEKY
VKKNEGEELIFNDDQNKLHIDTFEKYKYLICENINNDKFVIKNNQITTFEKFLKNQQNFEINNKWRDTLNKIKSQNNSMR
QFMQPKINNYNLCKYYVCSNNIEQIKKGALWNNTRLMGDIIKTKRENNNILNGDILNGDIINGDILNNDILNKDILNNDS
LNNDSLNNDSLNNDSLNNDILNNDIPNSDVSSNVHNISSEYLNNNDKENMKFCKWGRNIFARRLRGATFPETHDDRQKHC
FLFIDDYLTSNENKFDIINQNVKLRASDYNKWSVNMLYNFLKMIGLKKEAYLFKINKIRGYHILKLTDKELKKLNINNSY
VRKFVLSVFRFLTNSIDNADPLSLNYNSNKKFSFNNIENICNTHITILNKIGGGSYAQVFRAKYKTIHVACKIFLYKPKD
LAEESYCESYISTPRSSHRYIFPKINKNINGEDYKNTDMNNEKRKDQNIFTDNFHMDESSSMQHVPHVDDINYIEQEDNI
ENNTKYKNKKNNNDINNSSDTLQRNKKIKKMANLEIFRYFPTPVKYRNYEAKILYSLRECKHVIKLIGVCSLREGEESLI
LQHCPGGSLEKYIYKDEKKKNSPYAKSLTRPKLVKIFQQVAEGMYNIHTNQCFHRDLKLSNILLDENQNAVISDFGLSTN
FSSNDSPTAYAIYGNIFYAAPEVLKGEGFFKESDVWSFAVSLWEALTKKIAYDGISASEVFCKISSGELFLPIPKDIPME
LSELLKSMLEYDFTKRPLFNVIAKKLEQIRIQAEDKLHLDIMSFFDG

Gene-Specific Links for PF13_0258

General Sub-Cellular Localisation Links