ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0252 (NT1, ENT1)

nucleoside transporter 1, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during intraerythrocytic and ring and schizont and trophozoite
not food vacuole and not internal organelle and not maurer's cleft and not nuclear envelope and not nucleus and not parasitophorous vacuole membrane and not tubulovesicular membrane during schizont
not erythrocyte plasma membrane during ring and schizont and trophozoite
not erythrocyte cytosol during ring and schizont and trophozoite

Who localised this protein by microscopy?

Henry, R. I., Martin, R. E., Howitt, S. M., Kirk, K.
Localisation of a candidate anion transporter to the surface of the malaria parasite. (2007 Nov 16, Biochem Biophys Res Commun) PubMed / full text
   more detail about this publication

parasite plasma membrane during trophozoite
  • "The lower panel of Fig. 2B shows the PfSulP-HA-associated fluorescence co-localised with fluorescently labelled PfENT1, a transport protein shown previously to reside on the plasma membrane of the parasite [20. HA-associated fluorescence and PfENT1-associated fluorescence localised together at the parasite surface."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PPM during troph
  • Comment: Gene name annotation PfNT1 assumed to be the same because of the reference to the PfNT1 paper when talking about PfENT1
  • Other genes localised in this publication: inorganic anion exchanger, inorganic anion antiporter

Saliba, K. J., Martin, R. E., Broer, A., Henry, R. I., McCarthy, C. S., Downie, M. J., Allen, R. J., Mullin, K. A., McFadden, G. I., Broer, S., Kirk, K.
Sodium-dependent uptake of inorganic phosphate by the intracellular malaria parasite. (2006 Oct 5, Nature) PubMed / full text
   more detail about this publication

parasite plasma membrane during intraerythrocytic
  • "PfPiT localizes to the parasite surface, colocalizing with PfENT1 (red), a transport protein shown previously to reside on the plasma membrane of the parasite14."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: FAF-6
  • Gene model mapping comments: inferred from another publication
  • Localisation record: parasite surface during asexual
  • Other genes localised in this publication: sodium-dependent phosphate transporter

Rager, N., Mamoun, C. B., Carter, N. S., Goldberg, D. E., Ullman, B.
Localization of the Plasmodium falciparum PfNT1 nucleoside transporter to the parasite plasma membrane. (2001 Nov 2, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane and not erythrocyte plasma membrane during ring and schizont and trophozoite, not food vacuole and not internal organelle and not maurer's cleft and not nuclear envelope and not nucleus and not parasitophorous vacuole membrane and not tubulovesicular membrane during schizont, not erythrocyte cytosol during ring and schizont and trophozoite
  • "At the highest magnification visualized, it was evident that PfNT1 localizes predominantly to the PPM and not to the PVM (Fig. 3B). No immunogold labeling was observed at the RBCM, TVM, Maurer's clefts, nucleus, nuclear envelope, or any internal organelle (Fig. 3) including the food vacuole (data not shown)."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: HB3
  • Gene model mapping comments: Blast from primers TCTGGATCCATGAGTACCGGTAAAGAGTCATCTAAAGC and TTCGAATTCTGAAATGTTGTTTACTGCTTAATGTAGAT
  • Localisation record: Parasite Plasma Membrane and not PVM and not RBCM and not TVM and not maurer's clefts and not nucleus and not nuclear envelope and not internal organelles and not FV during schizont
  • Other genes localised in this publication: hexose transporter, protein phosphatase 2c
  • "Immunofluorescence analysis of PfNT1 stained with FITC-conjugated secondary antibody indicates that PfNT1 is found in ring (Fig. 2A), trophozoite (Fig. 2, panel B), and schizont (Fig. 2, C and D) parasites and appears to be localized to the membrane in all of these intraerythrocytic forms."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: HB3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PPM and not RBCM and not erythrocyte cytosol during ring and troph and schizont
  • Other genes localised in this publication: hexose transporter, protein phosphatase 2c

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33691

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0252 nucleoside transporter 1
MSTGKESSKAYADIESRGDYKDDGKKGSTLSSKQHFMLSLTFILIGLSSLNVWNTALGLNINFKYNTFQITGLVCSSIVA
LFVEIPKIMLPFLLGGLSILCAGFQISHSFFTDTQFDTYCLVAFIVIGVVAGLAQTIAFNIGSTMEDNMGGYMSAGIGIS
GVFIFVINLLLDQFVSPEKHYGVNKAKLLYLYIICELCLILAIVFCVCNLDLTNKNNKKDEENKENNATLSYMELFKDSY
KAILTMFLVNWLTLQLFPGVGHKKWQESHNISDYNVTIIVGMFQVFDFLSRYPPNLTHIKIFKNFTFSLNKLLVANSLRL
LFIPWFILNACVDHPFFKNIVQQCVCMAMLAFTNGWFNTVPFLVFVKELKKAKKKKEIEIISTFLVIAMFVGLFCGIWTT
YIYNLFNIVLPKPDLPPIDVTQ

Gene-Specific Links for PF13_0252

General Sub-Cellular Localisation Links