ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0248 (Pfs47)

6-cysteine protein, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during female gametocyte
during not intraerythrocytic and not male gametocyte

Who localised this protein by microscopy?

van Schaijk, B. C., van Dijk, M. R., van de Vegte-Bolmer, M., van Gemert, G. J., van Dooren, M. W., Eksi, S., Roeffen, W. F., Janse, C. J., Waters, A. P., Sauerwein, R. W.
Pfs47, paralog of the male fertility factor Pfs48/45, is a female specific surface protein in Plasmodium falciparum. (2006 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during female gametocyte, during not intraerythrocytic and not male gametocyte
  • "The combined data show that Pfs47 is expressed specifically on the surface of macrogametes."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: NF54
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: Surface during female gametocyte, not during asexual, not during male gametocyte
  • Other genes localised in this publication: alpha tubulin 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42857

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0248 6-cysteine protein
MCMGRMISIINIILFYFFLWVKKSISELLSSTQYVCDFYFNPLTNVKPTVVGSSEIYEEVGCTINNPTLGDHIVLICPKK
NNGDFSNIEIVPTNCFESHLYSAYKNDSSAYHLEKLDIDKKYAINSSFSDFYLKILVIPNEYKSHKTIYCRCDNSKTEKN
IPGQDKILKGKLGLVKIILRNQYNNIIELEKTKPIIHNKKDTYKYDIKLKESDILMFYMKEETIVESGNCEEILNTKINL
LSNNNVVIKMPSIFINNINCMLSSQDQNNEKNYINLKADKTKHIDGCDFTKPKGKGIYKNGFIINDIPNEEERICTVHLW
NKKNQTIAGIKCPYKLIPPYCFKHVLYEKEIDSQKTYKTFLLSDVLDTPNIEYYGNNKEGMYMLALPTKPEKTNKIRCIC
EQGGKKAVMELHIASTSTKYISMFLIFFLIVIFYMYVSI

Gene-Specific Links for PF13_0248

General Sub-Cellular Localisation Links