PF13_0247 (s-48/45)
6-cysteine protein, a
gene from Plasmodium falciparum
Compiled localisation
parasite plasma membrane during gametocyte
Who localised this protein by microscopy?
Bhowmick, I. P., Kumar, N., Sharma, S., Coppens, I., Jarori, G. K. Plasmodium falciparum enolase: stage-specific expression and sub-cellular localization. (2009, Malar J)
PubMed /
full text
   more detail about this publication
parasite plasma membrane during gametocyte
-
"This was evident from the disappearance of signals for aldolase (a cytosolic protein) (Figure 8B (a)) and a gametocyte membrane protein Pfs48/45 (Figure 8B (b)) in the detergent treated preparations."
-
Microscopy type: Light
-
Microscopy method: Monoclonal antibody directly to protein
-
Strain: 3D7 and NF54
-
Gene model mapping comments: Blast from AAF15364, annotation matches
-
Localisation record: PM during gametocyte
- Other genes localised in this publication:
enolase, fructose-bisphosphate aldolase, enolase
Orthology
OrthoMCL
Part of OrthoMCL group OG4_48410
Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
There are no non-apicomplexan genes that have manually annotated evidence codes.
Amino Acid Sequence
>PF13_0247 6-cysteine protein
MMLYISAKKAQVAFILYIVLVLRIISGNNDFCKPSSLNSEISGFIGYKCNFSNEGVHNLKPDMRERRSIFCTIHSYFIYD KIRLIIPKKSSSPEFKILPEKCFQKVYTDYENRVETDISELGLIEYEIEENDTNPNYNERTITISPFSPKDIEFFCFCDN TEKVISSIEGRSAMVHVRVLKYPHNILFTNLTNDLFTYLPKTYNESNFVSNVLEVELNDGELFVLACELINKKCFQEGKE KALYKSNKIIYHKNLTIFKAPFYVTSKDVNTECTCKFKNNNYKIVLKPKYEKKVIHGCNFSSNVSSKHTFTDSLDISLVD DSAHISCNVHLSEPKYNHLVGLNCPGDIIPDCFFQVYQPESEELEPSNIVYLDSQINIGDIEYYEDAEGDDKIKLFGIVG SIPKTTSFTCICKKDKKSAYMTVTIDSAYYGFLAKTFIFLIVAILLYI
Proteomics
Found in:
Not found in:
Gene-Specific Links for PF13_0247
General Sub-Cellular Localisation Links
-
PlasmoDB:
-
Malaria Parasite Metabolic Pathways
-
MalSig, prediction of P. falciparum
signal peptides
-
PSEApred, prediction of P. falciparum
proteins secreted into the infected erythrocyte
-
PlasMit, prediction of P. falciparum
mitochondrial transit peptides
-
P. falciparum
apicoplast leader predictors:
-
PlasmoDraft, predictions of P. falciparum gene function based on postgenomic data
-
TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
-
OrthoMCL, automatic clustering of orthologous groups of proteins
|