ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0247 (s-48/45)

6-cysteine protein, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during gametocyte

Who localised this protein by microscopy?

Bhowmick, I. P., Kumar, N., Sharma, S., Coppens, I., Jarori, G. K.
Plasmodium falciparum enolase: stage-specific expression and sub-cellular localization. (2009, Malar J) PubMed / full text
   more detail about this publication

parasite plasma membrane during gametocyte
  • "This was evident from the disappearance of signals for aldolase (a cytosolic protein) (Figure 8B (a)) and a gametocyte membrane protein Pfs48/45 (Figure 8B (b)) in the detergent treated preparations."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 3D7 and NF54
  • Gene model mapping comments: Blast from AAF15364, annotation matches
  • Localisation record: PM during gametocyte
  • Other genes localised in this publication: enolase, fructose-bisphosphate aldolase, enolase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48410

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0247 6-cysteine protein
MMLYISAKKAQVAFILYIVLVLRIISGNNDFCKPSSLNSEISGFIGYKCNFSNEGVHNLKPDMRERRSIFCTIHSYFIYD
KIRLIIPKKSSSPEFKILPEKCFQKVYTDYENRVETDISELGLIEYEIEENDTNPNYNERTITISPFSPKDIEFFCFCDN
TEKVISSIEGRSAMVHVRVLKYPHNILFTNLTNDLFTYLPKTYNESNFVSNVLEVELNDGELFVLACELINKKCFQEGKE
KALYKSNKIIYHKNLTIFKAPFYVTSKDVNTECTCKFKNNNYKIVLKPKYEKKVIHGCNFSSNVSSKHTFTDSLDISLVD
DSAHISCNVHLSEPKYNHLVGLNCPGDIIPDCFFQVYQPESEELEPSNIVYLDSQINIGDIEYYEDAEGDDKIKLFGIVG
SIPKTTSFTCICKKDKKSAYMTVTIDSAYYGFLAKTFIFLIVAILLYI

Gene-Specific Links for PF13_0247

General Sub-Cellular Localisation Links