ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0233 (MyoA, -myo1)

myosin A, a gene from Plasmodium falciparum

Compiled localisation
inner membrane complex during extracellular merozoite and merozoite
apical during merozoite
cytoplasm during early trophozoite and late trophozoite and ring and schizont

Who localised this protein by microscopy?

Daher, W., Pierrot, C., Kalamou, H., Pinder, J. C., Margos, G., Dive, D., Franke-Fayard, B., Janse, C. J., Khalife, J.
Plasmodium falciparum dynein light chain 1 interacts with actin/myosin during blood stage development. (2010 Jun 25, J Biol Chem) PubMed / full text
   more detail about this publication

cytoplasm during early trophozoite and late trophozoite and ring and schizont
  • "Interestingly, and in support of the interaction of PfDLC1 with actin, we found that the P. falciparum actin is distributed in the parasite cytoplasm (Fig. 7E)."
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during ring and young trophozoite and late trophozoite and schizont
  • Other genes localised in this publication: dynein light chain 1

Baum, J., Richard, D., Healer, J., Rug, M., Krnajski, Z., Gilberger, T. W., Green, J. L., Holder, A. A., Cowman, A. F.
A conserved molecular motor drives cell invasion and gliding motility across malaria life cycle stages and other apicomplexan parasites. (2006 Feb 24, J Biol Chem) PubMed / full text
   more detail about this publication

apical and inner membrane complex during merozoite

Green, J. L., Martin, S. R., Fielden, J., Ksagoni, A., Grainger, M., Yim Lim, B. Y., Molloy, J. E., Holder, A. A.
The MTIP-myosin A complex in blood stage malaria parasites. (2006 Feb 3, J Mol Biol) PubMed / full text
   more detail about this publication

apical and inner membrane complex during merozoite
  • "A Plasmodium falciparum protein which is exported into a new compartment in the host erythrocyte has been located. This protein, exp-1, has a variable region recognized by a monoclonal antibody."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: taken directly from 16321976
  • Localisation record: IMC and apical during merozoite
  • Other genes localised in this publication: myosin A tail domain interacting protein

Pinder, J. C., Fowler, R. E., Dluzewski, A. R., Bannister, L. H., Lavin, F. M., Mitchell, G. H., Wilson, R. J., Gratzer, W. B.
Actomyosin motor in the merozoite of the malaria parasite, Plasmodium falciparum: implications for red cell invasion. (1998 Jul, J Cell Sci) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular merozoite
  • "Immunofluorescence revealed that in the merozoite and mature schizont Pf-myo1 is predominantly located around the periphery of the cell. Immuno-gold electron microscopy also showed the presence of the myosin around almost the entire parasite periphery, and especially in the region surrounding the apical prominence. "
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly against protein
  • Strain: FCR-3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: IMC during extracellular merozoite
  • Comment: Strain not specified specifically, but taken from Blood-stage P. falciparum parasites were maintained in continuous culture (Trager and Jensen, 1976).
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10145

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF13_0233 myosin A
MAVTNEEIKTASKIVRRVSNVEAFDKSGSVFKGYQIWTDISPTIENDPNIMFVKCVVQQGSKKEKLTVVQIDPPGTGTPY
DIDPTHAWNCNSQVDPMSFGDIGLLNHTNIPCVLDFLKHRYLKNQIYTTAVPLIVAINPYKDLGNTTNEWIRRYRDTADH
TKLPPHVFTCAREALSNLHGVNKSQTIIVSGESGAGKTEATKQIMRYFASSKSGNMDLRIQTAIMAANPVLEAFGNAKTI
RNNNSSRFGRFMQLVISHEGGIRYGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGANSTMKSKFGLKGVTEYKLLNPNS
TEVSGVDDVKDFEEVIESLKNMELSESDIEVIFSIVAGILTLGNVRLIEKQEAGLSDAAAIMDEDMGVFNKACELMYLDP
ELIKREILIKVTVAGGTKIEGRWNKNDAEVLKSSLCKAMYEKLFLWIIRHLNSRIEPEGGFKTFMGMLDIFGFEVFKNNS
LEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTAELKYTSNKEVINVLCEKGKSVLSYLEDQCLAPGGTDEKFVSSC
ATNLKENNKFTPAKVASNKNFIIQHTIGPIQYCAESFLLKNKDVLRGDLVEVIKDSPNPIVQQLFEGQVIEKGKIAKGSL
IGSQFLNQLTSLMNLINSTEPHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFEEFLYQYKFVD
IAAAEDSSVENQNKCVNILKLSGLSESMYKIGKSMVFLKQEGAKILTKIQREKLVEWENCVSVIEAAILKHKYKQKVNKN
IPSLLRVQAHIRKKMVAQ

Gene-Specific Links for PF13_0233

General Sub-Cellular Localisation Links