ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0229 (IRPa)

aconitase, a gene from Plasmodium falciparum

Compiled localisation
cytosol and food vacuole and mitochondrion during trophozoite

Who localised this protein by microscopy?

Hodges, M., Yikilmaz, E., Patterson, G., Kasvosve, I., Rouault, T. A., Gordeuk, V. R., Loyevsky, M.
An iron regulatory-like protein expressed in Plasmodium falciparum displays aconitase activity. (2005 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol and food vacuole and mitochondrion during trophozoite
  • "Immunofluorescence analysis showed that PfIRPa colocalizes with heat shock protein 60 (Hsp60), a mitochondrial marker, and is also present in the parasitic cytosol/food vacuole."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondrion and cytosol and food vacuole during trophozoite
  • Other genes localised in this publication: heat shock protein 60

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10197

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF13_0229 aconitase
MHFRRCIRKYCINKKIVNPFEHVQRTLNEKNYYYYDINELHDSRIKSLPYSIRVLLESAVRNCDNLKVSEKNVETILGWK
ENCKKKKEVPFMPTRVLLQDLTGVPCIVDLATMRDTAEKLGCDAERINPLIPVDLVIDHSVQVDYSRREDALELNEKKEY
ERNLERFKFLKWGMNSFKNMLILPPGSGIVHQINLEYLAHCVFNKDNLLYPDSVVGTDSHTTMINGLGILGWGVGGIEAE
ATMLGLPISMTLPEVVGINVVGKLSDYLLSTDIVLYITSFLRKEVGVVNKYVEFFGTGLKDLKLADRATISNMAPEYGAT
VGFFPVDDITLEYLLQTGRDKEKVELIREYLMKNSMFNTYKDNVEYTDVYTLDLSKLNLSLSGPKRPHDNVLLSELHKDF
TMCLESPIGFKGYNIAKEEREKKISFVCSKDGKEYVLSQGSVVLCAITSCTNTSNSSSMIAAGLLAKKAIEEFGLKSLPY
IKSSLSPGSKTVQKYLEAGGLLKYLEQLGFYNVGYGCMTCIGNSGHLDEEVEEVINKNDLIVSSVLSGNRNFEGRVHPLI
KANYLASPVLVVLFSIIGNVNVDLSNYTFNYKGKKINALDLIPRKEEIEEYESTYIKPEMYTEIYKNIKYVNKYWNDIQI
KKNKLYEWDKNSTYIHKPPYFENMTLEIEKIQDIKDAHVLLFLGDSITTDHISPAGMIHKTSEAYKFLKTKNIKDQDLNT
YGARRGNDEVMIRGTFANIRLINKLCPDKGPNTIHIPTNQLMSVYQAAMKYKQDNIDVIIIAGKEYGCGSSRDWAAKGPN
LLGVKAVIAESYERIHRSNLIGMSVLPLQFINNQSPQYYNMDGTEKFTILLNDGNIKAQQTIKVQMNQKGKIIIFDVLCR
IDTEIEERYFRNGGILKYVLRSLVNEANK

Gene-Specific Links for PF13_0229

General Sub-Cellular Localisation Links