ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0218 (MDR5)

ABC transporter (MDR family), putative, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during early trophozoite and ring and schizont and trophozoite
food vacuole during trophozoite

Who localised this protein by microscopy?

Kavishe, R. A., van den Heuvel, J. M., van de Vegte-Bolmer, M., Luty, A. J., Russel, F. G., Koenderink, J. B.
Localization of the ATP-binding cassette (ABC) transport proteins PfMRP1, PfMRP2, and PfMDR5 at the Plasmodium falciparum plasma membrane. (2009, Malar J) PubMed / full text
   more detail about this publication

parasite plasma membrane during early trophozoite and ring and schizont and trophozoite, food vacuole during trophozoite
  • "PfMDR5 was clearly observed to localize to the surface of the parasite in all asexual stages (Figure 6). Trophozoite stages sometimes revealed a less intense intracellular staining around the food vacuole (Figure 6, B5 and D5). This pattern of staining though sometimes strong, was not consistent in the many slides scanned. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein epitope CQSTKYNSQCYQKNK
  • Strain: NF54
  • Gene model mapping comments: Taken directly from paper, blast from epitope CQSTKYNSQCYQKNK, annotation matches
  • Localisation record: PPM during rings and trophozoite and schizont and ring and early troph and dividing troph and schizont, sometimes FV during troph
  • Comment: no pubmed id yet
  • Other genes localised in this publication: ABC transporter, (CT family), putative, ABC transporter, (CT family), endoplasmic reticulum-resident calcium binding protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_45866

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0218 ABC transporter (MDR family), putative
MGNSLSLCLLRETSKDVFRYFESLYIKYFKSYNYINYITLKYNKKDDKMHRKKVITCADINEGPKNNRIKKENYIFRAFL
DMTKHEKTLLSLAMVFLIINAYTNINYPRIMGECIEASNHMNNNIFNNIHNNNNDNIFQSNDNVIYNTFCNINICNNVIN
FFFDKISFIKNYFVDRNIIKTIIFYFPYFICGGIASYMRIYFTNQCIKNIEIRLKKQVHDKILMNNEEEFKEYKTSDYLV
NCTFIEIKYSAKELITCITQTFRYMNSVVGGLISMSCISLYLTKLCLFIIPIYGLSVLCLLKSLKRIKIETTTMEEKQIA
RFSDSLQKKNIISLFGNESYEHRYFCKQLHVLNNLYDKYITCESIFYSFLNIGTNVVICTILCLGRLELTTQHITHGQLV
SFIVYSTMLGLGVGGMLKLKKDINLLQISLQKIYEILDLTKSETQTDINNYEQGKLTIQDKQVNLSKNKQSGNSMGKYKP
DNDDDNKEDNKEDSKDYNKDDNKDDNNDNNNDNNNDNNNDNNNDNNNDNNNDNNNDNNNDHHNDHNNDNNNVVMNELPFK
YPHKSNYIPNNIKGSIRFENVSFSYNHYDKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSYEGNIFID
NLNIKNIHNHFLKRNILSVSEQECCIFNRTIYENLIYGLVPLYIKNNNNNNNNNYYYQYLSKCIFQNMNPGNNIHKKILN
NIQSTKYNSQCYQKNKHNITSNFITQSYRTQDEDPHNISNHKHIDNTSRNIYQNYYTDFLNSYDEYKLNIINSSINVLCE
ELDLKQFINSMPHNIHSNIQYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITH
SIHILNKMDKIIILDDGKIRAIGTYEQIKNDTLFRDIFSLHKPAV

Gene-Specific Links for PF13_0218

General Sub-Cellular Localisation Links