ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0201 (TRAP, SSP2)

sporozoite surface protein 2, a gene from Plasmodium falciparum

Compiled localisation
microneme and parasite plasma membrane during sporozoite
cytoplasm during hemocoel sporozoite and salivary gland sporozoite

Who localised this protein by microscopy?

Robson, K. J., Frevert, U., Reckmann, I., Cowan, G., Beier, J., Scragg, I. G., Takehara, K., Bishop, D. H., Pradel, G., Sinden, R., et, a. l. ..
Thrombospondin-related adhesive protein (TRAP) of Plasmodium falciparum: expression during sporozoite ontogeny and binding to human hepatocytes. (1995 Aug 15, EMBO J) PubMed / full text
   more detail about this publication

cytoplasm during hemocoel sporozoite and salivary gland sporozoite
  • "The localization pattern of mAbs 19 F7, 1 C3 and 13 B9 was characterized by an intense cytoplasmic staining usually polarized on one of the two halves of the parasite (Figure 3). In the small fraction of haemocoel sporozoites showing the phenotype TRAP' CS protein' the labelling pattern of TRAP antibodies was identical to that of salivary gland sporozoites."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during salivary gland sporozoite, weak cytoplasm during hemocoel sporozoite
  • Comment: strain information not found
  • Other genes localised in this publication: -

Rogers, W. O., Malik, A., Mellouk, S., Nakamura, K., Rogers, M. D., Szarfman, A., Gordon, D. M., Nussler, A. K., Aikawa, M., Hoffman, S. L.
Characterization of Plasmodium falciparum sporozoite surface protein 2. (1992 Oct 1, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

microneme and parasite plasma membrane during sporozoite
  • "Murine antibodies against recombinant PfSSP2 identify a 90-kDa protein in extracts of P. falciparum sporozoites, recognize sporozoites and infected hepatocytes by immunofluorescence, localize PfSSP2 to the sporozoite micronemes by immunoelectron microscopy and to the surface membrane by live immunofluorescence, and inhibit sporozoite invasion and development in hepatocytes in vitro."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54, 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during sporozoite
  • Other genes localised in this publication: -
  • "Murine antibodies against recombinant PfSSP2 identify a 90-kDa protein in extracts of P. falciparum sporozoites, recognize sporozoites and infected hepatocytes by immunofluorescence, localize PfSSP2 to the sporozoite micronemes by immunoelectron microscopy and to the surface membrane by live immunofluorescence, and inhibit sporozoite invasion and development in hepatocytes in vitro."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NF54, 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33736

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_082735 sporozoite surface protein 2
  • PCHAS_135440 thrombospondin-related anonymous protein, putative
  • PKH_121770 sporozoite surface protein 2, putative
  • TA07755 thrombospondin-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0201 sporozoite surface protein 2
MNHLGNVKYLVIVFLIFFDLFLVNGRDVQNNIVDEIKYREEVCNDEVDLYLLMDCSGSIRRHNWVNHAVPLAMKLIQQLN
LNDNAIHLYASVFSNNAREIIRLHSDASKNKEKALIIIKSLLSTNLPYGKTNLTDALLQVRKHLNDRINRENANQLVVIL
TDGIPDSIQDSLKESRKLSDRGVKIAVFGIGQGINVAFNRFLVGCHPSDGKCNLYADSAWENVKNVIGPFMKAVCVEVEK
TASCGVWDEWSPCSVTCGKGTRSRKREILHEGCTSELQEQCEEERCLPKREPLDVPDEPEDDQPRPRGDNFAVEKPNENI
IDNNPQEPSPNPEEGKGENPNGFDLDENPENPPNPPNPPNPPNPPNPPNPDIPEQEPNIPEDSEKEVPSDVPKNPEDDRE
ENFDIPKKPENKHDNQNNLPNDKSDRYIPYSPLSPKVLDNERKQSDPQSQDNNGNRHVPNSEDRETRPHGRNNENRSYNR
KHNNTPKHPEREEHEKPDNNKKKAGSDNKYKIAGGIAGGLALLACAGLAYKFVVPGAATPYAGEPAPFDETLGEEDKDLD
EPEQFRLPEENEWN

Gene-Specific Links for PF13_0201

General Sub-Cellular Localisation Links