ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0133 (PM V, PM5, PMV)

plasmepsin V, a gene from Plasmodium falciparum

Compiled localisation
not food vacuole during trophozoite
endoplasmic reticulum during schizont and trophozoite
not golgi apparatus during schizont and trophozoite

Who localised this protein by microscopy?

Russo, I., Babbitt, S., Muralidharan, V., Butler, T., Oksman, A., Goldberg, D. E.
Plasmepsin V licenses Plasmodium proteins for export into the host erythrocyte. (2010 Feb 4, Nature) PubMed / full text
   more detail about this publication

endoplasmic reticulum during trophozoite
  • "Figure 1 | The transmembrane region of plasmepsin V confers ER localization. "
  • Microscopy type: Light
  • Microscopy method: YFP tag, GFP tag, antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during trophozoite
  • Other genes localised in this publication: -

Boddey, J. A., Hodder, A. N., Gunther, S., Gilson, P. R., Patsiouras, H., Kapp, E. A., Pearce, J. A., de Koning-Ward, T. F., Simpson, R. J., Crabb, B. S., Cowman, A. F.
An aspartyl protease directs malaria effector proteins to the host cell. (2010 Feb 4, Nature) PubMed / full text
   more detail about this publication

endoplasmic reticulum
  • "HA-tagged PMV localized to the ER, as has been shown previously for the endogenous protein"
  • Microscopy type: Light
  • Microscopy method: C terminal HA tag, antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: ER
  • Comment: stage information not found in publication
  • Other genes localised in this publication: erythrocyte membrane protein 3

Klemba, M., Goldberg, D. E.
Characterization of plasmepsin V, a membrane-bound aspartic protease homolog in the endoplasmic reticulum of Plasmodium falciparum. (2005 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum and not golgi apparatus during schizont and trophozoite
  • "Extensive colocalization of PM V and BiP was observed (Fig. 5C). In contrast, PM V did not colocalize with the Golgi marker ERD2 (Fig. 5D), which is distributed in small, juxtanuclear foci as previously described"
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody to residues 27-517
  • Strain: HB3
  • Gene model mapping comments: Taken directly from publication, annotation matches
  • Localisation record: ER and not Golgi during troph and schizont
  • Other genes localised in this publication: heat shock protein 70, ER lumen protein retaining receptor

Banerjee, R., Liu, J., Beatty, W., Pelosof, L., Klemba, M., Goldberg, D. E.
Four plasmepsins are active in the Plasmodium falciparum food vacuole, including a protease with an active-site histidine. (2002 Jan 22, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

not food vacuole during trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15516

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0133 plasmepsin V
MNNYFLRKENFFILFCFVFVSIFFVSNVTIIKCNNVENKIDNVGKKIENVGKKIGDMENKNDNVENKNDNVGNKNDNVKN
ASSDLYKYKLYGDIDEYAYYFLDIDIGKPSQRISLILDTGSSSLSFPCNGCKDCGIHMEKPYNLNYSKTSSILYCNKSNC
PYGLKCVGNKCEYLQSYCEGSQIYGFYFSDIVTLPSYNNKNKISFEKLMGCHMHEESLFLHQQATGVLGFSLTKPNGVPT
FVDLLFKHTPSLKPIYSICVSEHGGELIIGGYEPDYFLSNQKEKQKMDKSDNNSSNKGNVSIKLKNNDKNDDEENNSKDV
IVSNNVEDIVWQAITRKYYYYIKIYGLDLYGTNIMDKKELDMLVDSGSTFTHIPENIYNQINYYLDILCIHDMTNIYEIN
KRLKLTNESLNKPLVYFEDFKTALKNIIQNENLCIKIVDGVQCWKSLENLPNLYITLSNNYKMIWKPSSYLYKKESFWCK
GLEKQVNNKPILGLTFFKNKQVIFDLQQNQIAFIESKCPSNLTSSRPRTFNEYREKENIFLKVSYINLYCLWLLLALTIL
LSLILYVRKMFYMDYFPLSDQNKSPIQEST

Gene-Specific Links for PF13_0133

General Sub-Cellular Localisation Links