ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0128 ()

beta-hydroxyacyl-ACP dehydratase precursor, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13556

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0128 beta-hydroxyacyl-ACP dehydratase precursor
  • PBANKA_133820 beta-hydroxyacyl-ACP dehydratase precursor, putative
  • PY01586 beta-hydroxyacyl-ACP dehydratase precursor
  • PVX_116720 beta-hydroxyacyl-ACP dehydratase precursor, putative
  • PCHAS_134280 beta-hydroxyacyl-ACP dehydratase precursor, putative
  • PKH_123010 beta-hydroxyacyl-ACP dehydratase precursor, putative
  • NCLIV_004340 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF13_0128 beta-hydroxyacyl-ACP dehydratase precursor
MRFLIIHIAVIVLPFVLMIDVKRENSFFLRHSPKRLYKKADYNNMYDKIIKKQQNRIYDVSSQINQDNINGQNISFNLTF
PNYDTSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGLKQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKS
DDSQKNNLFLFAGVDGVRWKKPVLPGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFALSK

Gene-Specific Links for PF13_0128

General Sub-Cellular Localisation Links