ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0090 ()

ADP-ribosylation factor, putative, a gene from Plasmodium falciparum

Compiled localisation
intracellular and not exported during intraerythrocytic

Who localised this protein by microscopy?

van Ooij, C., Tamez, P., Bhattacharjee, S., Hiller, N. L., Harrison, T., Liolios, K., Kooij, T., Ramesar, J., Balu, B., Adams, J., Waters, A. P., Janse, C. J., Haldar, K.
The malaria secretome: from algorithms to essential function in blood stage infection. (2008 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

intracellular and not exported during intraerythrocytic

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48283

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0090 ADP-ribosylation factor, putative
MNVLDVLKRWFILVFFMLQRFFEFKSKITKKSFIIFGLPSSGKTSIIYFFKLGYLITTVSTLFINEENFKINLKIEKDDT
KEQNYDITFYEVGKNCSYNLIKEYSDISNDVIYIVDSVQKGNLSEARDDFIRILYEFRFIYRKCKFLIFMNKQDSNGCLS
SQEIINFFALPKDLLIRCNFISCSTLSGQGLKEGLEWLLYYNLPFYNNELNCIDRRTATKHLEL

Gene-Specific Links for PF13_0090

General Sub-Cellular Localisation Links