ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0088 (Myb1)

Myb1-related transcription factor, a gene from Plasmodium falciparum

Compiled localisation
nucleus

Who localised this protein by microscopy?

Gissot, M., Briquet, S., Refour, P., Boschet, C., Vaquero, C.
PfMyb1, a Plasmodium falciparum transcription factor, is required for intra-erythrocytic growth and controls key genes for cell cycle regulation. (2005 Feb 11, J Mol Biol) PubMed / full text
   more detail about this publication

nucleus
  • "Using chromatin immuno-precipitation, we demonstrated that PfMyb1 binds, within the parasite nuclei, to several promoters and therefore participates directly in the transcriptional regulation of the corresponding genes."
  • Microscopy type: ChIP
  • Microscopy method: antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: Nucleus
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_36920

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0088 Myb1-related transcription factor
MFNNNNEYECLCILEEKLVKHLDVIDKLIENIYDNINNLNEYINKKYNEIKILASKKPTRINWMKCDDKTHMSLFFDKKI
GFIPSNEDALKILDSQLMLSNYRKKYEYKKNSWTKKDIDKLFETVDITLKKYACYYLIDQNLSCDEKINKKKMIEQSEPK
QIFSQIKLFFDKYNKENTHNKGNEDNVNKNINDNISKNNITHTQNCYEPIEKEQDNSNNIFSYTKNDKNIEHNFLYFSET
FWNEVSEKLSNNQNAKECQKMWLYYGCFEDDKQKKWTKDEVDKLLCLSKKYEQRNWKCIARELNTNRSPLSCFEQYIKIN
KLYENKEKVKLERIAFNVLEDIQLQILVSIIGDKNWAEVKKHMESLNSNTSRIKKRKTNLNFFEKEKQKKFLNDEISYKR
RYLRLISATNNMEQ

Gene-Specific Links for PF13_0088

General Sub-Cellular Localisation Links