ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0085 (UBC13)

serine/threonine protein kinase, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and parasitophorous vacuole membrane during early trophozoite and late ring and late trophozoite
merozoite surface and not parasitophorous vacuole membrane during schizont

Who localised this protein by microscopy?

Philip, N., Haystead, T. A.
Characterization of a UBC13 kinase in Plasmodium falciparum. (2007 May 8, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

cytoplasm and parasitophorous vacuole membrane during early trophozoite and late ring and late trophozoite, merozoite surface and not parasitophorous vacuole membrane during schizont
  • "(B) Immunofluorescence using polyclonal anti-PfPK9 antibody reveals a punctuate staining at late ring stage during which PfPK9 (green) appears to colocalize with exported protein 1 (red) in several spots. In addition to parasitophorous membrane staining (using EXP-1 as PVM marker), diffused cytoplasmic staining is observed during both early and late trophozoites. During the schizont stage, the expression pattern emerges to be like merozoite surface protein 1 (red), a plasma membrane protein."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper, length matches, annotation matches
  • Localisation record: punctate PVM and diffuse cytoplasm during late ring and early troph and late troph, merozoite surface and not PVM during schizont
  • Other genes localised in this publication: circumsporozoite-related antigen, merozoite surface protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_35143

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF13_0085 serine/threonine protein kinase
MYLGSIKNFEDDFLCKGEYKQVYLSLEQNENNEAIEIDICCDNNIYDILQFCREKYGIYGEYIIDSCGNVIHSIKDIIDG
DTLYLKEKKEDMNFFSKIKNNFIVNDYIVEKRIGSGGFGIVFQGVHIQTKQKVALKFIPKSNFLDVTDVHRVFIEIQTLR
GLIHNNIIKMYDVNHFQNYVCLIMEYAINGDLKNYIKNKFNGFLSEKEAHDLFLQIVKGVYYCHSKHIVHRDLKLENILL
DEKMTCKIADFGLSDFVNVDQNIKTEAGTKAYIAPEIIFNQTINYSVFKLDIWSLGILLFIMTQGFAPFKYMEKELKNFE
SNTLNYANDISDDLKDLISLMLNVDPNKRPIIVEILNHRWFENYKES

Gene-Specific Links for PF13_0085

General Sub-Cellular Localisation Links