ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0083 (LplA)

lipoate protein ligase a type 1, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during late trophozoite and ring and segmenter and trophozoite

Who localised this protein by microscopy?

Wrenger, C., Muller, S.
The human malaria parasite Plasmodium falciparum has distinct organelle-specific lipoylation pathways. (2004 Jul, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during late trophozoite and ring and segmenter and trophozoite
  • "In contrast, expression of the N-terminal 113 amino acids of P. falciparum LplA fused to GFP resulted in a clear staining of the parasite's mitochondrion, as shown by co-localization with MitoTracker (Fig.4B)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Blast from NP_705054, annotation matches
  • Localisation record: Mitochondria during ring and troph and old trophozoite and segmenter
  • Other genes localised in this publication: lipoate synthase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10925

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF13_0083 lipoate protein ligase a type 1
MKRIFRLVRRCHYSTEKRTNGPLVLVSNNQNIHFNLSLENFLLNNYNDLLKYLNINTIEKFNEPILFLWRNNRSIIIGKN
QNIWSECNLKNIKEDGVLVARRFTGGGAVYHDLGNVCFTFLNNNINTSSNFLIILNTLKNHFNIEAKTQGRNDITVNDQK
CSGSAFKKIKDVFLHHGTILINLEKNILNKYLTPDKIKYIKHGVSSVNARTINLSEINNNITCENLCIALIKEFTKFYEQ
NYKENINNIKNLENNINNSNFQNKEQININNTNENNLINNTNIIPNDITVHYIDQNNNITKNPEFLKYYNLLKDWDWCYG
KTPKFQNHIWKQFTFGKLELFFNVSNGFIKDGNIFSDCLDINLIDHLKSIFNNDIKYSKEDISIFFKKLNVENKNYLDEV
RSWILQEL

Gene-Specific Links for PF13_0083

General Sub-Cellular Localisation Links