ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0065 (Vacuolar ATP H+ Synthase subunit a)

vacuolar ATP synthase subunit a, a gene from Plasmodium falciparum

Compiled localisation
cytoplasmic vesicle and food vacuole and not mitochondrion and not nuclear envelope and not nucleus and parasite plasma membrane and parasitophorous vacuole membrane during intraerythrocytic

Who localised this protein by microscopy?

Hayashi, M., Yamada, H., Mitamura, T., Horii, T., Yamamoto, A., Moriyama, Y.
Vacuolar H(+)-ATPase localized in plasma membranes of malaria parasite cells, Plasmodium falciparum, is involved in regional acidification of parasitized erythrocytes. (2000 Nov 3, J Biol Chem) PubMed / full text
   more detail about this publication

cytoplasmic vesicle and food vacuole and parasite plasma membrane and parasitophorous vacuole membrane and not mitochondrion and not nuclear envelope and not nucleus during intraerythrocytic
  • "As shown in Fig. 2, immunogold for V-ATPase subunit A selectively labeled food vacuoles (Fig. 2, A and C), small clear vesicles (Fig. 2, A and D), and the plasma membrane (Fig. 2, A and E). Immunogold particles were also occasionally observed in the parasitophorus vacuolar membrane (Fig. 2F), whereas essentially no labeling was seen in the nuclear envelope, nucleus (Fig. 2G), and mitochondrion (Fig. 2H). Control antibodies gave the essentially no labeling (Fig. 2B). A comparable immunogold labeling was also obtained with antibodies against V-ATPase subunit B (Fig. 2, I-L). "
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody to homologue
  • Strain: FCR-3
  • Gene model mapping comments: Blast from L08200, annotation matches
  • Localisation record: Parasite Plasma Membrane and cytoplasmic vesicles and FV and weak PV membrane and not nuclear envelope and not nucleus and not mitochondrion during asexual
  • Other genes localised in this publication: vacuolar ATP synthase subunit b

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10722

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_141040 vacuolar ATP synthase subunit a, putative
  • PY01556 V-type ATPase, A subunit
  • PVX_122430 vacuolar ATP synthase catalytic subunit A, putative
  • PCHAS_141230 vacuolar ATP synthase subunit a, putative
  • PKH_141110 vacuolar ATP synthase catalytic subunit A, putative
  • TGME49_056970 vacuolar ATP synthase catalytic subunit A, putative
  • NCLIV_029990 vacuolar ATP synthase catalytic subunit A, putative
  • cgd7_5000 vacuolar ATP synthase subunit A
  • Chro.70559 vacuolar ATP synthase catalytic subunit a
  • CMU_019130 vacuolar ATP synthase catalytic subunit A, putative
  • TA10370 vacuolar H+-ATPase, a subunit, putative
  • BBOV_III008150 vacuolar ATP synthase catalytic subunit A
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF13_0065 vacuolar ATP synthase subunit a
MTKVAVEKEEPGVVYKVAGSLVIAENMSGTRMYELAKVGWNKLVGEIIRLEGNYAYIQVYEDTSGLSVGDPVIKTGNALS
VELGPGILDNIYDGIQRPLERIANVCGDVYIYKGIDMTSLDHDKQWQFYADKKLKLNDIVTGGDIFGFVDENKLFKEHKI
MAPPNAKGRLTYIAPDGSYTLKDKIFELEYQGKKYTYGLSHLWPVRDPRPVLEKVTGDTLLLTGQRVLDSLFPTVQGGTC
AIPGAFGCGKTCVSQALSKYSNSEVIIYVGCGERGNEMAEILSDFPELTTKVDNEDVGIMQRTCLVANTSNMPVAAREAS
IYTGITLCEYFRDMGYNATMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGKVKCIGSPSRIGSITI
VGAVSPPGGDFSDPVTTATMSIVQAFWGLDKKLAQRKHFPSVNWSTSFSKYVRQLEQYFDNFDQDFLSLRQKISDILQQE
SDLNDIVQLVGKDSLSEDQKVVMEVAKIIREDFLQQNAFSDYDYMCPLQKTVGMMRIICHFYAQCLRTLQEYDSRERKIG
WGSIYNTLRPTINKITHMKFENPKNSDEYFKKYFKALEEEITVGLRNLMEK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PF13_0065

General Sub-Cellular Localisation Links

blog comments powered by Disqus