ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF13_0011 (g27)

gamete antigen 27/25, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during early gametocyte and gametocyte stage iii-v and gametocyte and late gametocyte
not parasite plasma membrane during gametocyte
during not intraerythrocytic
nucleus during early gametocyte and gametocyte stage iii-v and late gametocyte
not erythrocyte cytoplasm and not mitochondrion and not osmiophilic body and not parasitophorous vacuole and nuclear matrix during gametocyte stage iii-v

Who localised this protein by microscopy?

Camarda, G., Bertuccini, L., Singh, S. K., Salzano, A. M., Lanfrancotti, A., Olivieri, A., Scaloni, A., Sharma, A., Alano, P.
Regulated oligomerisation and molecular interactions of the early gametocyte protein Pfg27 in Plasmodium falciparum sexual differentiation. (2010 May, Int J Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during early gametocyte and gametocyte stage iii-v and late gametocyte, nuclear matrix and not erythrocyte cytoplasm and not mitochondrion and not osmiophilic body and not parasitophorous vacuole during gametocyte stage iii-v
  • "Here we reveal a previously unreported localisation of Pfg27 in the gametocyte nucleus by immunoelectron microscopy and studies with HaloTag and Green Fluorescent Protein fusions, and identify a network of interactions established by the protein during gametocyte development."
  • Microscopy type: Light
  • Microscopy method: GFP tag, HT tag
  • Strain: 3D7A
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Diffuse cytoplasm and nucleus during early gametocyte and late gametocyte
  • Other genes localised in this publication: sexual stage-specific protein precursor
  • "On the contrary, gold particles specific for the anti-Pfg27 antibodies readily decorated both the gametocyte cytoplasm and the nucleoplasm. In the latter, gold particles were homogeneously distributed both in the matrix and in the nucleolus (Fig. 2 B-F). Also, in the cytoplasm reactivity appeared diffuse, although specific compartments such as mitochondria (Fig. 2C), osmiophilic bodies (Fig. 2D), as well as parasitophorous vacuole and the erythrocyte cytoplasm (Fig. 2E and F) were clearly devoid of Pfg27-specific gold particles."
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain: 3D7A
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nuclear matrix and nucleolus and cytoplasm and not mitochondria and not osmiophilic bodies and not parasitophorous vacuole and not erythrocyte cytoplasm during stage III-V gametocyte
  • Other genes localised in this publication: sexual stage-specific protein precursor

Carter, R., Graves, P. M., Creasey, A., Byrne, K., Read, D., Alano, P., Fenton, B.
Plasmodium falciparum: an abundant stage-specific protein expressed during early gametocyte development. (1989 Aug, Exp Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and not parasite plasma membrane during gametocyte, during not intraerythrocytic
  • "By indirect immunofluorescence with a monoclonal antibody 1H12 specific for Pfg 27/25, this protein is present in gametocytes within 30 to 40 hr after invasion of a red blood cell by a merozoite and is present throughout subsequent maturation of the gametocyte; Pfg 27/25 is not detectable on the surface of extracellular gametes by immunofluorescence with Mab 1H12."
  • Microscopy type:
  • Microscopy method:
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm and not surface during gametocyte, not during asexual
  • Comment: no electronic fulltext
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PF13_0011 gamete antigen 27/25
MSKVQKDSAKPLDKFGNIYDYHYEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDPEKFNYALKDRVSIRRYVRKN
QNRYNYFLIEERVQDNIVNRISDRLISYCTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDHAREVKEKKRIMNDKKLIR
MLFDTYEYVKDVKFTDDQYKDAAARISQFLIDVVDSYIIKPIPALPVTPDEPHHNNI

Gene-Specific Links for PF13_0011

General Sub-Cellular Localisation Links