ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0465 (DYN1)

dynamin-like protein, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum and erythrocyte plasma membrane and food vacuole membrane and nuclear membrane and parasite plasma membrane and parasitophorous vacuole membrane during late intraerythrocytic

Who localised this protein by microscopy?

Li, H., Han, Z., Lu, Y., Lin, Y., Zhang, L., Wu, Y., Wang, H.
Isolation and functional characterization of a dynamin-like gene from Plasmodium falciparum. (2004 Jul 30, Biochem Biophys Res Commun) PubMed / full text
   more detail about this publication

endoplasmic reticulum and erythrocyte plasma membrane and food vacuole membrane and nuclear membrane and parasite plasma membrane and parasitophorous vacuole membrane during late intraerythrocytic
  • "Immunoelectron microscope observation showed that Pfdyn1 is localized broadly inside the parasite-infected erythrocyte and associated with several membrane structures. The immunogold particles were observed in the cytoplasm of parasite and associated with membrane-like organelles such as food vacuoles, nucleus membrane, and some other unconfirmed membrane structures (Fig. 5). Those particles were also seen in the cytoplasm of erythrocyte and on the parasite plasma membrane (PPM), parasitophorous vacuole membrane (PVM), and even erythrocyte plasma membrane (EPM)."
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: Dd2
  • Gene model mapping comments: Blast from AF336796, annotation matches
  • Localisation record: Er and pv membrane and fv membrane and Erythrocyte plasma membrane and parasite plasma membrane and nuclear membrane during late asexual stage
  • Other genes localised in this publication: heat shock protein 70

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10138

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0465 dynamin-like protein
METSMYNNLRKLINVIDELRDIGLQKYINLPRICVVGTQSSGKSSVLESIVGMDFLPRGEGIVTRRPIEFRLIHIKEDSE
IKYWAVFENEKNKKYTDFNEVREQINRLTDEIAGKNKGIIDEPIVLNIYSIKCPDLSLIDLPGITRVPLKNSDQTDDIER
LTRDMALRYVKDPRTIILAVLPANADMSTSDALQIARKVDPKGLRTIGVITKIDLMDKGADASKMLLNDEINLRLGYTGV
VNRSTADIKKGKTISQALKDELEFFQKHPVYKKLPPALYGTNSLTDKLTKVLLRHIKNFLPDIKIEINDKIRYINDKLYE
LGTNVPLDATKKTQLLWSMITDYCEIFKNTLKGKYDKRVQVFIENNDILCGLKVRTIFNEFLDEYVGKNVTSELTDNDID
DAICLHEGDSLPGFPSPDTFEFLILPHLKKINAPVFNCLDRVSQTLEILSQKIANRVLNRFPKLSEQVLELSQTILIREK
ENTQIILENYIDAETNYLFTNDASYLIEHGSIINAADDEHNENHNNTTNINNNNNNNNSSSYDYGIQHRNQNKRQQSNIS
NSNQDTLLSTSSKYYSNMMSDQEYNITGKAAKFVTSAQKSVMNIWNTKEKKKTRYNAQFIQEIRRRLDCYFNIVLRNVRD
SVPKMIGYFLIRKLQEKMQFELYSDLNSEQKLYDLLNEPPNVVKEREHLNNQLEILKKANQVLLKDPNITSINLDLFDAN
YEQDLMDYQKSLKNTNQFNQSSKHNPNMSQGSSANMSMYLNDGSSSMSKRNPMMHNRNMSPSSMNTNMMKQTNMLGQKMG
NSPSSYMQQGHMNDSKGKHLFEKEPMKKKVNYNPLFD

Gene-Specific Links for PF11_0465

General Sub-Cellular Localisation Links