ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0461 (Rab6) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

Rab GTPase 6, a gene from Plasmodium falciparum

Compiled localisation
trans golgi during ring and schizont and trophozoite
not cis-golgi during ring and schizont and trophozoite
cis-golgi during ring and schizont and trophozoite
golgi apparatus during ring and schizont and trophozoite
cytosol during ring and schizont

Who localised this protein by microscopy?

Deplaine, G., Lavazec, C., Bischoff, E., Natalang, O., Perrot, S., Guillotte-Blisnick, M., Coppee, J. Y., Pradines, B., Mercereau-Puijalon, O., David, P. H.
Artesunate tolerance in transgenic Plasmodium falciparum parasites overexpressing a tryptophan-rich protein. (2011 Jun, Antimicrob Agents Chemother) PubMed / full text
   more detail about this publication

golgi apparatus during trophozoite
  • "here was no significant overlap with the Golgi apparatus, visible upon labeling with a rabbit anti PfRab6 antibody (Supplemental material Figure 3)."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: FCR3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi during trophozoite
  • Other genes localised in this publication: tryptophan-rich antigen 3

Struck, N. S., Herrmann, S., Schmuck-Barkmann, I., de Souza Dias, S., Haase, S., Cabrera, A. L., Treeck, M., Bruns, C., Langer, C., Cowman, A. F., Marti, M., Spielmann, T., Gilberger, T. W.
Spatial dissection of the cis- and trans-Golgi compartments in the malaria parasite Plasmodium falciparum. (2008 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

cytosol and trans golgi during ring and schizont
  • "Fluorescence microscopy of parasites expressing WT GFP–Rab6 revealed a distinct fluorescent focus in young parasites with some ER staining and a faint cytosolic pool (Fig. 2C) … In ring stage parasites (< 16 h post invasion), the cis- (represented by GRASP–GFP) and trans-Golgi (represented by DsRed–Rab6) are equally numbered, tightly associated and partially overlapping (Fig. 3B panel a and Fig. 3C image 1). Multiplication of the two distinct Golgi faces appears to be synchronized (Fig. 3B panel b) and starts before nuclear division (data not shown and Struck et al., 2005)."
  • Microscopy type: Light
  • Microscopy method: N terminal DsRed tag, antibody, N terminal GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: trans golgi and faint cytosol during ring and schizont
  • Other genes localised in this publication: protein transport protein Sec13, putative, heat shock protein 70, golgi re-assembly stacking protein 1

Adisa, A., Frankland, S., Rug, M., Jackson, K., Maier, A. G., Walsh, P., Lithgow, T., Klonis, N., Gilson, P. R., Cowman, A. F., Tilley, L.
Re-assessing the locations of components of the classical vesicle-mediated trafficking machinery in transfected Plasmodium falciparum. (2007 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

trans golgi and not cis-golgi during ring and schizont and trophozoite
  • "We also compared the location of PfBet3p with the trans Golgi marker PfRab6. PfRab6 has previously been reported to be located in a compartment that is spatially separate from the cis Golgi ([de Castro et al., 1996 and [Van Wye et al., 1996)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: trans golgi and not cis golgi during ring and troph and schizont
  • Other genes localised in this publication: small GTP-binding protein sar1, Bet3 transport protein, putative, golgi re-assembly stacking protein 1

Witola, W. H., Pessi, G., El Bissati, K., Reynolds, J. M., Mamoun, C. B.
Localization of the phosphoethanolamine methyltransferase of the human malaria parasite Plasmodium falciparum to the Golgi apparatus. (2006 Jul 28, J Biol Chem) PubMed / full text
   more detail about this publication

golgi apparatus during ring and schizont and trophozoite
  • "o identify the exact cellular localization of the native enzyme, we have generated three different transgenic parasites expressing either GFP alone targeted to the cytoplasm, GFP containing a C-terminal SDEL retention signal and, thus, targeted to the ER, or GFP fused to the Golgi apparatus marker Rab6 (25, 26) (Fig. 5)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: golgi during ring and troph and schizont
  • Other genes localised in this publication: phosphoethanolamine N-methyltransferase, protein phosphatase 2c, heat shock protein 70

Struck, N. S., de Souza Dias, S., Langer, C., Marti, M., Pearce, J. A., Cowman, A. F., Gilberger, T. W.
Re-defining the Golgi complex in Plasmodium falciparum using the novel Golgi marker PfGRASP. (2005 Dec 1, J Cell Sci) PubMed / full text
   more detail about this publication

trans golgi and not cis-golgi during ring

de Castro, F. A., Ward, G. E., Jambou, R., Attal, G., Mayau, V., Jaureguiberry, G., Braun-Breton, C., Chakrabarti, D., Langsley, G.
Identification of a family of Rab G-proteins in Plasmodium falciparum and a detailed characterisation of pfrab6. (1996 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cis-golgi during ring and schizont and trophozoite
  • "Immunofluorescence analysis showed that the distribution of PfRab6 within the parasite changes markedly during the intraerythrocytic cycle (Fig. 5). As the parasite matures, the fluorescence pattern becomes increasingly punctate, until in the most mature parasites we see a single spot of Rab6 fluorescence associated with each parasite nucleus. This observation is consistent with the reported localization of the cis-Golgi marker, ERD2 [9."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Dd2
  • Gene model mapping comments: Blast from X92977.1, annotation matches, gene model inconsistent
  • Localisation record: cis golgi during ring and troph and schizont
  • Other genes localised in this publication: -

Van Wye, J., Ghori, N., Webster, P., Mitschler, R. R., Elmendorf, H. G., Haldar, K.
Identification and localization of rab6, separation of rab6 from ERD2 and implications for an 'unstacked' Golgi, in Plasmodium falciparum. (1996 Dec 2, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

trans golgi and not cis-golgi during ring and trophozoite
  • "The plasmodial homologue of ERD2 (PfERD2) is concentrated in a single perinuclear region in a ring-stage parasite. This site is distinct from the Pfrab6 membranes, indicating that early and late Golgi markers can be segregated in P. falciparum."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCB
  • Gene model mapping comments: Blast from U70366, gene model inconsistent
  • Localisation record: late golgi and not early golgi during ring and troph
  • Other genes localised in this publication: ER lumen protein retaining receptor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10702

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0461 Rab GTPase 6
MDEFQNSGLNKYKLVFLGEQAVGKTSIITRFMYDTFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQERFRSLIPSY
IRDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDVIIALVGNKTDLGDLRKVTYEEGMQKAQEYNTMFHETSAKAGHN
IKVLFKKIASKLPNLDNTNNNEANVVDIQLTNNSNKNDKNMLSKCLC

Gene-Specific Links for PF11_0461

General Sub-Cellular Localisation Links