ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0436 (CPO)

coproporphyrinogen III oxidase, a gene from Plasmodium falciparum

Compiled localisation
cytosol and not apicoplast and not mitochondrion during intraerythrocytic

Who localised this protein by microscopy?

Nagaraj, V. A., Prasad, D., Arumugam, R., Rangarajan, P. N., Padmanaban, G.
Characterization of coproporphyrinogen III oxidase in Plasmodium falciparum cytosol. (2010 Jun, Parasitol Int) PubMed / full text
   more detail about this publication

cytosol and not apicoplast and not mitochondrion during intraerythrocytic
  • "The results presented in Fig. 4 indicate that the PfCPO signal was distributed throughout the parasite, but did not colocalize with that of Mitotracker dye (mitochondrial marker), PfALAS (mitochondrial marker) or PfUROD (apicoplast marker)."
  • Microscopy type: Light
  • Microscopy method: antibody to whole protein
  • Strain:
  • Gene model mapping comments: taken directly from publication, annotation matches
  • Localisation record: cytosol and not mitochondria and not apicoplast during erythrocytic
  • Comment: strain information not found
  • Other genes localised in this publication: uroporphyrinogen III decarboxylase, delta-aminolevulinic acid synthetase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11669

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0436 coproporphyrinogen III oxidase
MKDEIAPNEYFRNLWENLLKSEQNNICSLIESLDNKKFQEEVWYRKSGKNKNLGGGITRILEDGNIFEKCAVNYSCIYGA
IDKESAKQMCVNHYNKEFINTTKICHSDDINILISRVLNSHNIRIINEKYKFYASGISIIAHPVNPNVPTVHMNFRFFQI
FIKTGKKKKKYNNLNNVNNNNLNNNLNNNFVKNKIDNNYKSIKHWFGGGCDLSPCYIFPDLFTEFHNSFKLVCDKYNHLF
YRHFKIWCDLYFRIKHRNINRGIGGIFFDNLLNNIIKNKKVIRSGKLKDINKKNGNDPTINNNNNNNKDCKCYSCNNIMD
KSYRMIYFFIQECIINFRKSYLHILLETVNFKYDDNMLKWQRVCRGRYVEFNLLYDRGTKFGIELNRYKIYRRKKKQKKL
ENYSSTNFIKDEIFDEQVSDYLSDEHEKIDNVFSSLPLKCDFQYKYKIEKYSREYETLEILKYPKKWVDY

Gene-Specific Links for PF11_0436

General Sub-Cellular Localisation Links