ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0396 (PP2C)

protein phosphatase 2c, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during schizont
cytosol during ring and schizont and trophozoite

Who localised this protein by microscopy?

Witola, W. H., Pessi, G., El Bissati, K., Reynolds, J. M., Mamoun, C. B.
Localization of the phosphoethanolamine methyltransferase of the human malaria parasite Plasmodium falciparum to the Golgi apparatus. (2006 Jul 28, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol during ring and schizont and trophozoite
  • "The non-cytoplasmic nature of the fluorescence pattern was further confirmed by immunocolocalization studies using antibodies directed against the parasite protein phosphatase 2C (19, 23), which resides in the parasite cytoplasm, and monoclonal antibodies against GFP to detect the Pfpmt-GFP fusion (Fig. 1C)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol during ring and troph and schizont
  • Other genes localised in this publication: phosphoethanolamine N-methyltransferase, heat shock protein 70, Rab GTPase 6

Rager, N., Mamoun, C. B., Carter, N. S., Goldberg, D. E., Ullman, B.
Localization of the Plasmodium falciparum PfNT1 nucleoside transporter to the parasite plasma membrane. (2001 Nov 2, J Biol Chem) PubMed / full text
   more detail about this publication

cytoplasm during schizont
  • "A parallel incubation with primary antibodies against PfHT1, a protein previously shown to be associated with the PPM (31), demonstrates a similar reticulated staining pattern (Fig. 2E), whereas antibodies specific for the cytosolic P.falciparum protein phosphatase 2C enzyme (32) produce a diffuse staining pattern indicative of its cytoplasmic milieu (Fig. 2F)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: HB3
  • Gene model mapping comments: Blast from AF023665, annotation matches
  • Localisation record: cytoplasm during schizont
  • Other genes localised in this publication: nucleoside transporter 1, hexose transporter

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10167

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0396 protein phosphatase 2c
MGAYLSSPKTNKESLDGGNLELDPSRYGLSCMQGWRKNMEDAHICYNNLKFNEIEEDVSIYGVFDGHGGPNVSKWISYNF
RRIFIRCLKEANEEMIKKNMKRSENYKLKLIKLTLEKTFLKLDEEMLLSENQEKLKKYSVPTQEDEEESDTRENYIYSIL
NDIISKNISIKAIEKDGKRCLQVVYNKDGSPVEEGNTDGSATSTLNQDQPEHNQLYEDGNDNNNSNNNNNNNNNNISPNL
YGTNGENILRSDENYDSSNLNLGDNQDRKNYDDIENLGDNNNSSNDMLKKDDASSDILTATTSTNDMKDEDKKNNYLVEK
NEHMKKENNNCEENSEQNKQVNGMSSYNKALIEGAMGESIDEKGLLNLNDIKTNNILIDNNNDSNNNNNNNNNNNNSSSN
DPSMFSTAYAHHCNNNEGTIGDYLNNEENNETNNIKRLKKDICNDEKGNTQNDIKEEDKMRNMETYMNEPIDGVKSELTY
DNLKSMEEQEKNGEIEQGINNMIDHFQSNNLLNNDNTNGNINSYTNDDIHNNGSLQGYEQDGLIQNRNNGDEVNNSDIER
LAYDEASANVIDNNINNDIHEEDEDDENNNNDEETGEDDCNGVYSSEELRLFENYYSNDYEDNIAYSCGSTALVAVILKG
YLIVANAGDSRAIVCFNGNSLGMSTDHKPHLQTEEARIKKAGGYIANGRVDGNLNLTRAIGDLHYKRDPFLPQKDQKISA
FPEITCVTLTPEDEFLFLACDGIWDCKDGQDVVGFVKTRLEKFEEIPDDPNNSLDNTENSEHMNTNNNSDQNEKLKSEDQ
NNINNEQENILNTSNNDFQKNENLLNENNMDNINMQEKSETEEDLDLERDEDKHDAPPVIERKKYEKFNKLSQICEELCD
ECLSNNYKENDGIGCDNMTCLIVQYNPEYKIHTEKKFLNIDDIE

Gene-Specific Links for PF11_0396

General Sub-Cellular Localisation Links