ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0344 (AMA-1, AMA1)

apical membrane antigen 1, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during after microneme exocytosis and merozoite
apical end of surface and rhoptry during merozoite
microneme during extracellular merozoite and late schizont and late trophozoite or schizont and merozoite and schizont and segmenter
apical during intraerythrocytic and schizont and segmenter
not rhoptry during extracellular merozoite and schizont and segmenter
moving junction during invasion
rhoptry neck during late schizont and merozoite
cytoplasm and not parasite plasma membrane during sporozoite

Who localised this protein by microscopy?

Ito, D., Han, E. T., Takeo, S., Thongkukiatkul, A., Otsuki, H., Torii, M., Tsuboi, T.
Plasmodial ortholog of Toxoplasma gondii rhoptry neck protein 3 is localized to the rhoptry body. (2011 Jun, Parasitol Int) PubMed / full text
   more detail about this publication

microneme during schizont

Proellocks, N. I., Kats, L. M., Sheffield, D. A., Hanssen, E., Black, C. G., Waller, K. L., Coppel, R. L.
Characterisation of PfRON6, a Plasmodium falciparum rhoptry neck protein with a novel cysteine-rich domain. (2009 May, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during late schizont
  • "Confocal microscopy using anti-rPfRON6-B with anti-Pf34 (rhoptry neck marker), anti-PfRON4 (rhoptry neck marker), anti-RAMA (rhoptry bulb marker), or anti-AMA1 (microneme marker)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during segmented schizont
  • Other genes localised in this publication: rhoptry neck protein 6, apical merozoite protein, rhoptry neck protein 4, rhoptry-associated membrane antigen

Cao, J., Kaneko, O., Thongkukiatkul, A., Tachibana, M., Otsuki, H., Gao, Q., Tsuboi, T., Torii, M.
Rhoptry neck protein RON2 forms a complex with microneme protein AMA1 in Plasmodium falciparum merozoites. (2009 Mar, Parasitol Int) PubMed / full text
   more detail about this publication

microneme during merozoite
  • "Colocalization of PfRON2 with PfRON4 (rhoptry neck marker) was observed but neither colocalized with PfClag3.1 (rhoptry body marker) nor PfAMA1 (microneme marker). "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: Dd2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during merozoite
  • Other genes localised in this publication: rhoptry neck protein 2, rhoptry neck protein 4, cytoadherence linked asexual protein 3.2

Baum, J., Chen, L., Healer, J., Lopaticki, S., Boyle, M., Triglia, T., Ehlgen, F., Ralph, S. A., Beeson, J. G., Cowman, A. F.
Reticulocyte-binding protein homologue 5 - an essential adhesin involved in invasion of human erythrocytes by Plasmodium falciparum. (2009 Feb, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during extracellular merozoite and segmenter, moving junction during invasion

Wickramarachchi, T., Devi, Y. S., Mohmmed, A., Chauhan, V. S.
Identification and characterization of a novel Plasmodium falciparum merozoite apical protein involved in erythrocyte binding and invasion. (2008, PLoS One) PubMed / full text
   more detail about this publication

apical end of surface and parasite plasma membrane during merozoite
  • "AMA1 was present over the entire surface of merozoites but is most densely distributed at the apical tip (Figure 5A), whereas EBA175 tends to be restricted to the apical end (Figure 5B) as shown earlier [8, [9."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface and strong apical end of surface during merozoite
  • Other genes localised in this publication: asparagine-rich protein, merozoite surface protein 1, erythrocyte binding antigen-175, cytoadherence linked asexual protein 3.2

Pendyala, P. R., Ayong, L., Eatrides, J., Schreiber, M., Pham, C., Chakrabarti, R., Fidock, D. A., Allen, C. M., Chakrabarti, D.
Characterization of a PRL protein tyrosine phosphatase from Plasmodium falciparum. (2008 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical during intraerythrocytic

Singh, S., Plassmeyer, M., Gaur, D., Miller, L. H.
Mononeme: a new secretory organelle in Plasmodium falciparum merozoites identified by localization of rhomboid-1 protease. (2007 Dec 11, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

microneme

Proellocks, N. I., Kovacevic, S., Ferguson, D. J., Kats, L. M., Morahan, B. J., Black, C. G., Waller, K. L., Coppel, R. L.
Plasmodium falciparum Pf34, a novel GPI-anchored rhoptry protein found in detergent-resistant microdomains. (2007 Sep, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during late trophozoite or schizont
  • "Late stage parasites were stained with anti-Pf34 (green) and anti-RAMA (red) (i) or anti-Pf34 (green) and anti-AMA-1 (red) (ii) antibodies, highlighting the differential expression of the rhoptry proteins (Pf34 and RAMA) when compared with AMA-1 (microneme protein)"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during late troph or schizont
  • Other genes localised in this publication: apical merozoite protein, rhoptry-associated membrane antigen, high molecular weight rhoptry protein 3

Yeoh, S., O'Donnell, R. A., Koussis, K., Dluzewski, A. R., Ansell, K. H., Osborne, S. A., Hackett, F., Withers-Martinez, C., Mitchell, G. H., Bannister, L. H., Bryans, J. S., Kettleborough, C. A., Blackman, M. J.
Subcellular discharge of a serine protease mediates release of invasive malaria parasites from host erythrocytes. (2007 Dec 14, Cell) PubMed / full text
   more detail about this publication

microneme during schizont

Gaur, D., Singh, S., Singh, S., Jiang, L., Diouf, A., Miller, L. H.
Recombinant Plasmodium falciparum reticulocyte homology protein 4 binds to erythrocytes and blocks invasion. (2007 Nov 6, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

microneme during merozoite
  • "The native PfRH4 was found to be localized at the apical pole of the merozoite (Fig. 6 A and B). Because there was not perfect colocalization with known rhoptry and microneme marker proteins, RON4 and AMA-1, respectively (Fig. 6 A and B), further analysis by immunoelectron microscopy is essential for determining the precise location of PfRH4 in the merozoite."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: reticulocyte binding protein homologue 4, rhoptry neck protein 4

Pearce, J. A., Mills, K., Triglia, T., Cowman, A. F., Anders, R. F.
Characterisation of two novel proteins from the asexual stage of Plasmodium falciparum, H101 and H103. (2005 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during late schizont

O'Keeffe, A. H., Green, J. L., Grainger, M., Holder, A. A.
A novel Sushi domain-containing protein of Plasmodium falciparum. (2005 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme and not rhoptry during schizont
  • "Double staining immunofluorescence assays (IFA) of 3D7 schizonts showed the staining pattern of the anti-ASP antibodies to be indistinguishable from that of the monoclonal antibody 4G2 that binds to AMA-1 in micronemes [18 (Fig. 5A) but they were distinct from that of antibody specific for the rhoptry protein, RhopH2 [16 (Fig. 5B). "
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and not rhoptry during schizont
  • Other genes localised in this publication: apical sushi protein, high molecular weight rhoptry protein 2

Winter, G., Kawai, S., Haeggstrom, M., Kaneko, O., von Euler, A., Kawazu, S., Palm, D., Fernandez, V., Wahlgren, M.
SURFIN is a polymorphic antigen expressed on Plasmodium falciparum merozoites and infected erythrocytes. (2005 Jun 6, J Exp Med) PubMed / full text
   more detail about this publication

microneme during merozoite
  • "In double-labeling experiments, SURFIN4.2 did not colocalize with the microneme apical merozoite antigen (AMA)-1 (15, 16), but was present in a crescent-shaped cap attached to the merozoite apical pole (Fig. 6 E)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during merozoite
  • Other genes localised in this publication: surface-associated interspersed gene 4.2, (SURFIN4.2)

Thompson, J., Cooke, R. E., Moore, S., Anderson, L. F., Janse, C. J., Waters, A. P.
PTRAMP; a conserved Plasmodium thrombospondin-related apical merozoite protein. (2004 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme and not rhoptry during extracellular merozoite and schizont and segmenter
  • "PTRAMP is a merozoite surface protein that originates in the micronemes. Immunofluorescence assays were performed on fixed smears of mixed stage parasites using affinity purified PTRAMP antisera in conjunction with sera detecting the microneme protein AMA-1 or the rhoptry protein RAP1"
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody 4G2 directly to protein
  • Strain: IT0/A4
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and not rhoptry during schizont and segmenter and released merozoites
  • Other genes localised in this publication: thrombospondin-related apical membrane protein, rhoptry-associated protein 1, thrombospondin-related apical membrane protein

Silvie, O., Franetich, J. F., Charrin, S., Mueller, M. S., Siau, A., Bodescot, M., Rubinstein, E., Hannoun, L., Charoenvit, Y., Kocken, C. H., Thomas, A. W., Van Gemert, G. J., Sauerwein, R. W., Blackman, M. J., Anders, R. F., Pluschke, G., Mazier, D.
A role for apical membrane antigen 1 during invasion of hepatocytes by Plasmodium falciparum sporozoites. (2004 Mar 5, J Biol Chem) PubMed / full text
   more detail about this publication

cytoplasm and not parasite plasma membrane during sporozoite, parasite plasma membrane during after microneme exocytosis
  • "In contrast, surface labeling with the anti-AMA-1 mAb showed no or very little surface fluorescence on sporozoites (Fig. 1C). When detected, AMA-1 surface fluorescence was restricted to the apical extremity of the sporozoites, on the same side of the nucleus as the apicoplast, a DNA-containing organelle visualized as a DAPI-positive spot forward of the nucleus, as described in Toxoplasma (21, 22). Upon incubation at 37 C, which induces microneme exocytosis (26, 27), most of the sporozoites (~60-80%) expressed AMA-1 on their surface, distributed either over the whole surface or as a posterior cap (see Fig. 5B)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm and not surface during sporozoite, surface during after microneme exocytosis
  • Comment: strain information not found
  • Other genes localised in this publication: -

Howard, R. F., Narum, D. L., Blackman, M., Thurman, J.
Analysis of the processing of Plasmodium falciparum rhoptry-associated protein 1 and localization of Pr86 to schizont rhoptries and p67 to free merozoites. (1998 Apr 1, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane and rhoptry during merozoite
  • "Taken together, the present results show p67 (and p82) are present in merozoites and that neither of these RAP-1 products are relocalized to the surface of merozoites under conditions that promote the surface localization of PF83/AMA-1."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody 28G2dc1 and 4G2dc1
  • Strain: FCB-1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry and surface during merozoite
  • Other genes localised in this publication: rhoptry-associated protein 1

Mohrle, J. J., Zhao, Y., Wernli, B., Franklin, R. M., Kappes, B.
Molecular cloning, characterization and localization of PfPK4, an eIF-2alpha kinase-related enzyme from the malarial parasite Plasmodium falciparum. (1997 Dec 1, Biochem J) PubMed / full text
   more detail about this publication

apical during schizont and segmenter
  • "As observed by immunoelectron microscopy, RAP-1 is localized within the body of the rhoptry [43,52; PF83/AMA-1 is localized more anteriorally within the rhoptry neck [43. PfPK4 does not co-localize with RAP-1."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: K1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical during segmenter and schizont
  • Other genes localised in this publication: protein kinase PK4, rhoptry-associated protein 1

Crewther, P. E., Culvenor, J. G., Silva, A., Cooper, J. A., Anders, R. F.
Plasmodium falciparum: two antigens of similar size are located in different compartments of the rhoptry. (1990 Feb, Exp Parasitol) PubMed / full text
   more detail about this publication

rhoptry neck during late schizont and merozoite, parasite plasma membrane during merozoite
  • "In immunoelectron microscopic studies, QF3 was found in the body of the rhoptry whereas AMA-1 was consistently found in the neck of the rhoptry."
  • Microscopy type: Light, EM
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry neck during mature schizont and merozoite, surface during merozoite
  • Comment: fulltext not available online
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27887

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF11_0344 apical membrane antigen 1
MRKLYCVLLLSAFEFTYMINFGRGQNYWEHPYQNSDVYRPINEHREHPKEYEYPLHQEHTYQQEDSGEDENTLQHAYPID
HEGAEPAPQEQNLFSSIEIVERSNYMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIEN
SNTTFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVY
DDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNC
EDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTGAFKADRYKSHGKGYNWG
NYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVENNFPCSLYKDEIMKEIERESKRIKLNDNDDEGNKKIIAPRIF
ISDDKDSLKCPCDPEMVSNSTCRFFVCKCVERRAEVTSNNEVVVKEEYKDEYADIPEHKPTYDKMKIIIASSAAVAVLAT
ILMVYLYKRKGNAEKYDKMDEPQDYGKSNSRNDEMLDPEASFWGEEKRASHTTPVLMEKPYY

Gene-Specific Links for PF11_0344

General Sub-Cellular Localisation Links