ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0339 (H-protein)

glycine cleavage H protein, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during intraerythrocytic

Who localised this protein by microscopy?

Spalding, M. D., Allary, M., Gallagher, J. R., Prigge, S. T.
Validation of a modified method for Bxb1 mycobacteriophage integrase-mediated recombination in Plasmodium falciparum by localization of the H-protein of the glycine cleavage complex to the mitochondrion. (2010 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during intraerythrocytic
  • "The H-protein is localized exclusively to the mitochondrion (Figure 2B), indicating that this component of the glycine cleavage pathway resides in this organelle."
  • Microscopy type: Live light
  • Microscopy method: GFP tag
  • Strain: Dd2
  • Gene model mapping comments: taken directly from publication
  • Localisation record: mitochondrion during erythrocytic
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10611

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_091550 glycine cleavage system H protein, putative
  • PY05949 probable glycine cleavage system h protein
  • PVX_092250 hypothetical protein, conserved
  • PCHAS_093050 glycine cleavage system H protein, putative
  • PKH_093070 glycine cleavage system H protein, putative
  • TGME49_002960 glycine cleavage system H protein, putative
  • NCLIV_021960 Glycine cleavage system H protein, mitochondrial (Precursor), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0339 glycine cleavage H protein
MINIRKVLLPSCVITKSFLNNYYKRLITYYTKTHEYIKIEDGNLNNRKDMTNVKCKIGISNYGTHKLGEIVYVDVAHNIN
DHVKKGDCIATIESVKSVGDVYTPVSGKIININNKIIDNVNLMNEQSEIDGWIMELETNQINEKEIMNISEYEKMCEEEE
QNEEKKIQQNEINCMEEKNKNKIFDINDMKNIENKGQGGK

Gene-Specific Links for PF11_0339

General Sub-Cellular Localisation Links