ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0338 (AQP)

aquaglyceroporin, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and not erythrocyte cytosol and not erythrocyte plasma membrane and peripheral during intraerythrocytic

Who localised this protein by microscopy?

Hansen, M., Kun, J. F., Schultz, J. E., Beitz, E.
A single, bi-functional aquaglyceroporin in blood-stage Plasmodium falciparum malaria parasites. (2002 Feb 15, J Biol Chem) PubMed / full text
   more detail about this publication

cytoplasm and peripheral and not erythrocyte cytosol and not erythrocyte plasma membrane during intraerythrocytic
  • "The parasite's pigment vacuoles are clearly visible in the bright-field images. The immunostaining covers the whole parasite with some brighter patches around the rim. No staining is visible in the erythrocyte cytosol or membrane. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: blast from AJ413249, annotation matches
  • Localisation record: cytoplasm and parasite rim and not erythrocyte cytosol and not erythrocyte membrane during asexual
  • Comment: protein localised at the 'free trophozoite' stage, but trophozoites are never free.
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10111

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0338 aquaglyceroporin
MHMLFYKSYVREFIGEFLGTFVLMFLGEGATANFHTTGLSGDWYKLCLGWGLAVFFGILVSAKLSGAHLNLAVSIGLSSI
NKFDLKKIPVYFFAQLLGAFVGTSTVYGLYHGFISNSKIPQFAWETSRNPSISLTGAFFNELILTGILLLVILVVVDENI
CGKFHILKLSSVVGLIILCIGITFGGNTGFALNPSRDLGSRFLSLIAYGKDTFTKDNFYFWVPLVAPCVGSVVFCQFYDK
VICPLVDLANNEKDGVDL

Gene-Specific Links for PF11_0338

General Sub-Cellular Localisation Links