ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0313 (P0)

60S ribosomal protein P0, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during emerged gametocyte and merozoite

Who localised this protein by microscopy?

Chatterjee, S., Singh, S., Sohoni, R., Kattige, V., Deshpande, C., Chiplunkar, S., Kumar, N., Sharma, S.
Characterization of domains of the phosphoriboprotein P0 of Plasmodium falciparum. (2000 Apr 15, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during emerged gametocyte and merozoite
  • "Merozoites and sexual stages showed surface reactivity to both anti-PfP0N and anti-PfP0C antibodies in immunofluorescence assays."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from U56663, annotation matches
  • Localisation record: surface during merozoite and red cell-membrane free gametocytes
  • Comment: strain information not found
  • Other genes localised in this publication: 6-cysteine protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10528

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0313 60S ribosomal protein P0
MAKLSKQQKKQMYIEKLSSLIQQYSKILIVHVDNVGSNQMASVRKSLRGKATILMGKNTRIRTALKKNLQAVPQIEKLLP
LVKLNMGFVFCKDDLSEIRNIILDNKSPAPARLGVIAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQEHVHL
IKQGEKVTASSATLLQKFNMKPFSYGVDVRTVYDDGVIYDAKVLDITDEDILEKFSKGVSNVAALSRATGVITEASYPHV
FVEAFKNIVALIIDSDYTFPLMENIKKMVENPEAFAAVAAPASAAKADEPKKEEAKKVEEEEEEEEDGFMGFGMFD

Gene-Specific Links for PF11_0313

General Sub-Cellular Localisation Links