ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0302 (PV-1)

parasitophorous vacuolar protein 1, a gene from Plasmodium falciparum

Compiled localisation
maurer's cleft and parasitophorous vacuole during trophozoite

Who localised this protein by microscopy?

Nyalwidhe, J., Lingelbach, K.
Proteases and chaperones are the most abundant proteins in the parasitophorous vacuole of Plasmodium falciparum-infected erythrocytes. (2006 Mar, Proteomics) PubMed / full text
   more detail about this publication

maurer's cleft and parasitophorous vacuole during trophozoite
  • "The protein encoded by PfPV-1 is concentrated in a distinct ring surrounding the parasite cell, and this location is distinct from that of the erythrocyte membrane (Fig. 4A). It colocalizes with the vacuolar marker protein PfEXP-2 (Fig. 4B) and with PfSBP1 (Fig. 4C), suggesting that it is present not only in the PV but also in Maurers clefts."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCBR
  • Gene model mapping comments: Taken directly from publication, blast from NCTEAQQQAQEQTQEQTEE
  • Localisation record: PV and Maurer's clefts during trophozoite
  • Other genes localised in this publication: exported protein 2, skeleton-binding protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48336

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF11_0302 parasitophorous vacuolar protein 1
MIKIILASFLFFFYFSSSIYGNVVAPKSAEAVHTLTAKLDTENKAHQKYIDIINGVFSENMENFVFSITTSNGFTCSINK
LDVIFDNKVTGMQKVFSDENVQYIKEASLEFKNNLLEYMKGVMPSENDFSNVRKEFQKVCVKYFSELRRKFFQIYRDPNN
KNQNEDNVDNHMNIEEISQEFFSGFNPFGTMKIRKEQNPDLSQKDSLILNENNNDSLTSADQKNNNMVPMENRSFSYSQQ
SSHVVSFDGHDEHVEQQEQHSGDNTQEDKDQLMDLPFNKDKVFSTFLKNVTLLIEGNCTEAQQQAQEQTQEQTEEQEEEQ
NEKEIESDKQVQKDGEQKENDVQKKQKANAFTIQFSSSLSRKHISTTCNASSGNVFLRKGNKPFEHFNSPNFENMMKGVF
GIIQNPFENGQPTFPFFKNINSISGIGNVDIPKNFMNDFLNNGNDQNTPISS

Gene-Specific Links for PF11_0302

General Sub-Cellular Localisation Links