ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0301 (SPDS)

spermidine synthase, a gene from Plasmodium falciparum

Compiled localisation
cytosol and not exported during trophozoite

Who localised this protein by microscopy?

Haider, N., Eschbach, M. L., Dias Sde, S., Gilberger, T. W., Walter, R. D., Luersen, K.
The spermidine synthase of the malaria parasite Plasmodium falciparum: molecular and biochemical characterisation of the polyamine synthesis enzyme. (2005 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol and not exported during trophozoite
  • "Within a triple-infected erythrocyte (A) the P. falciparum spermidine synthase protein localised throughout the parasite, indicative for a cytoplasmatic localisation (B). The merge picture (C) shows that the distribution of the P. falciparum spermidine synthase protein is restricted to the parasite."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Blast from AJ271622, annotation matches
  • Localisation record: Cytosol and not exported during troph
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10453

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0301 spermidine synthase
MDKLISNNKLKLSVVLLGGLCSLAYYHLKNKFHLSQFCFSKKWFSEFSIMWPGQAFSLKIKKILYETKSKYQNVLVFEST
TYGKVLVLDGVIQLTEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYF
KNISCGYEDKRVNVFIEDASKFLENVTNTYDVIIVDSSDPIGPAETLFNQNFYEKIYNALKPNGYCVAQCESLWIHVGTI
KNMIGYAKKLFKKVEYANISIPTYPCGCIGILCCSKTDTGLTKPNKKLESKEFADLKYYNYENHSAAFKLPAFLLKEIEN
I

Gene-Specific Links for PF11_0301

General Sub-Cellular Localisation Links