ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0256 (PDH E1a)

pyruvate dehydrogenase E1 alpha subunit, a gene from Plasmodium falciparum

Compiled localisation
nowhere except apicoplast during intraerythrocytic

Who localised this protein by microscopy?

Foth, B. J., Stimmler, L. M., Handman, E., Crabb, B. S., Hodder, A. N., McFadden, G. I.
The malaria parasite Plasmodium falciparum has only one pyruvate dehydrogenase complex, which is located in the apicoplast. (2005 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

nowhere except apicoplast during intraerythrocytic
  • "Colocalization with the apicoplast-resident protein ACP using -ACP antibodies unambiguously shows that the presequences of PDH subunits E1 and E2 are sufficient to target proteins exclusively to the apicoplast (A and C)."
  • Microscopy type: Light
  • Microscopy method: GFP tag after 191 amino acids
  • Strain: D10
  • Gene model mapping comments: Blast from AY484441, annotation matches
  • Localisation record: Apicoplast only during asexual
  • Other genes localised in this publication: dihydrolipoamide acyltransferase component E2, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10672

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_092380 pyruvate dehydrogenase E1 component, alpha subunit, putative
  • PVX_091840 pyruvate dehydrogenase E1 component, alpha subunit, putative
  • PCHAS_092060 pyruvate dehydrogenase E1 component, alpha subunit, putative
  • PKH_092200 pyruvate dehydrogenase alpha subunit, putative
  • NCLIV_062940 pyruvate dehydrogenase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0256 pyruvate dehydrogenase E1 alpha subunit
MLLVIWLNIFWFIPYYCFNYVLCVGNKNDMLFVKNKNLIYPYNDMNRIRRHKGVELSRKMVAENIQMRNMKSNNNSNNVH
ENNNIDHSNNYNNNLYLSCSNKKKGKDVQSLCAIKHGNVLIKNINEEEKEKGIKKNDTDKLESKNDNEHKNEENNFVFSY
DKKLNNYSEFNIYMENNNIEEYISDVNISREEICTLYEDMYLGRLFENLVAKLYYNKRVNGFVHLYNGQEAVSTGIIKNL
KNSDFVTSTYRDHVHALSKGVPAHKILNELYGNYYGSTNKGKGGSMHIYSKENNFIGGFGFIGEQIPIAVGLAYSILYKN
EFHYNPKNTSFTSTKNKNNYIQENENMIHMNNSQNVDVVVCFLGDGTTNIGQFFESLNLASSYNLPIIFVIENNNWAIGM
ESSRSSSDDLMNNYSKGKAFNIDTFKVDGNDVLTIYKLAKKKIQQIRNRTSGPIIIEAITYRAKGHSLADPDELRIKEEK
TSWKKRDPILFLSSYMKKYNLVQESYFEQVKKNTQTLLQQAELDAEQNTKKGEHIDICNVIQQNIFAPSKSTPYQSEYEN
YKQFDDISNDELKEYYQEVLKEIQRKKEKKKLDPNDKFDQKKLPLIID

Gene-Specific Links for PF11_0256

General Sub-Cellular Localisation Links