ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0225 (GCN20)

ABC transporter GCN20, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during early ring and late ring
erythrocyte cytoplasm and intracellular during late ring
cytoplasmic side of erythrocyte membrane during early schizont and late trophozoite

Who localised this protein by microscopy?

Bozdech, Z., VanWye, J., Haldar, K., Schurr, E.
The human malaria parasite Plasmodium falciparum exports the ATP-binding cassette protein PFGCN20 to membrane structures in the host red blood cell. (1998 Nov 30, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm during early ring and late ring, erythrocyte cytoplasm and intracellular during late ring, cytoplasmic side of erythrocyte membrane during early schizont and late trophozoite
  • "PFGCN20 was found to be present at all stages and a pronounced export of PFGCN20 into the erythrocyte was observed in the trophozoite and schizont stages."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FAC8
  • Gene model mapping comments: Blast from U37225, annotation matches
  • Localisation record: discrete compartments at parasite periphery during early ring, discrete compartments at parasite periphery and homogenous parasite and throughout erythrocyte cytoplasm during late ring, cytoplasmic face of erthrocyte plasma membrane during late troph and early schizont
  • Other genes localised in this publication: histidine-rich protein II

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10388

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0225 ABC transporter GCN20
MMEELFKILFELVKIGDEEIQNYLKERIIDEKYEIEKNGVDYFYDLVCSYADDKIKRSKIANIFNKHFKNDNIQNGSNPN
NIPNQHVLSIQNNKNLEKLEEVFNFKEYWKDKDMSNYSDPFLGVYEKQINYNTSVPISESLKISKEKEKQKQKQLNLFKE
WVKNKPKIPQPVRVHNLLHCSDVGKNKTKIDKLYDIRIDNFNISIGQRSLLSDTTLKINVMNKYGLIGKNGIGKSTLLAK
LARYEIEEIKKDISIACIEQELCLENVTVLESVLMVDKLRHDLLLELEQLEARKIKLDPNEEILSNETEEKNTQKNDTKN
NKHNKNNKNVENMEPIETVESIEQKILDIYEKLNSISYLEAEKEASKILCGLGFDSNLQKKKVNSLSGGMKMRLCLSRIL
FSNNDIILLDEPTNHLDIYTIQFLIDYIKKLNKTCIIVSHDRDFLNEVCTDIIHFHNHQLTYYSGNYDQFEKTRIEHLLQ
QQREHDSLELKKKHVQKFIDRFRYNSKRAALVQSRIKLLNKLPVVNLEKEDTPFSFSFLEPFYMSNVLIKLKNVSFRNKM
FTNLRVRKNKNILIGDHENETNEETYEDENELDNNGQPVSKTYEDKYKFKHEYLFKNASFEVDMDSRIAICGVNGSGKTT
LIKIILNLITVYEGELHVSNKANIGYYSQYHVDCLNPIYNSIQQLQYTYSNKNIKEEEAIKYFNKFNIPTNILYEPIYVL
SGGQKSKLALAILAYKNPNVLILDEPSNHLDIESVQALIVALNMYKGGLIIISHDTYLIKHVADEIYHINNITKELVKID
YEFDKYTQLLLNNKI

Gene-Specific Links for PF11_0225

General Sub-Cellular Localisation Links