ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0224 (exp-1, EXP1, EXP-1)

circumsporozoite-related antigen, a gene from Plasmodium falciparum

Compiled localisation
parasitophorous vacuole membrane during early trophozoite and gametocyte and late ring and late trophozoite and schizont
gametocyte attached erythrocytic vesicle and intracellular during gametocyte
parasitophorous vacuole
erythrocyte cytoplasmic structure and maurer's cleft during trophozoite
parasitophorous vacuole lumen during intraerythrocytic

Who localised this protein by microscopy?

Jackson, K. E., Spielmann, T., Hanssen, E., Adisa, A., Separovic, F., Dixon, M. W., Trenholme, K. R., Hawthorne, P. L., Gardiner, D. L., Gilberger, T., Tilley, L.
Selective permeabilization of the host cell membrane of Plasmodium falciparum-infected red blood cells with streptolysin O and equinatoxin II. (2007 Apr 1, Biochem J) PubMed / full text
   more detail about this publication

parasitophorous vacuole lumen during intraerythrocytic
  • "A GFP chimaera of the signal sequence of EXP1 is trafficked to the PV lumen where it is present as a soluble protein [19]."
  • Microscopy type: live light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV lumen during intraerythrocytic
  • Other genes localised in this publication: erythrocyte membrane protein 1, PfEMP1, ring-exported protein 3

Philip, N., Haystead, T. A.
Characterization of a UBC13 kinase in Plasmodium falciparum. (2007 May 8, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during early trophozoite and late ring and late trophozoite and schizont
  • "EXP1 is a marker for the PVM, which forms the hostparasite interface."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM during late ring and early troph and late troph and schizont
  • Other genes localised in this publication: serine/threonine protein kinase, merozoite surface protein 1

Spielmann, T., Fergusen, D. J., Beck, H. P.
etramps, a new Plasmodium falciparum gene family coding for developmentally regulated and highly charged membrane proteins located at the parasite-host cell interface. (2003 Apr, Mol Biol Cell) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane

Wickert, H., Wissing, F., Andrews, K. T., Stich, A., Krohne, G., Lanzer, M.
Evidence for trafficking of PfEMP1 to the surface of P. falciparum-infected erythrocytes via a complex membrane network. (2003 Jun, Eur J Cell Biol) PubMed / full text
   more detail about this publication

maurer's cleft during trophozoite
  • "Here we present evidence for a continuous membrane network of parasite origin in the erythrocyte cytoplasm. Co-localizations with antibodies against PfEMP1, PfExp-1, Pf332 and PfSbp1 at the light and electron microscopical level indicate that this membrane network is composed of structures that have been previously described as tubovesicular membrane network (TVM), Maurers clefts and membrane whorls. "
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: HB3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Maurer's Cleft during troph
  • Other genes localised in this publication: antigen 332, DBL-like protein, skeleton-binding protein 1, erythrocyte membrane protein 1, PfEMP1

Adisa, A., Albano, F. R., Reeder, J., Foley, M., Tilley, L.
Evidence for a role for a Plasmodium falciparum homologue of Sec31p in the export of proteins to the surface of malaria parasite-infected erythrocytes. (2001 Sep, J Cell Sci) PubMed / full text
   more detail about this publication

parasitophorous vacuole
  • "Asynchronous infected erythrocytes (K1 strain) were probed with affinity-purified rabbit anti-PfSec31(WD) antiserum followed by a fluorescein-conjugated anti-rabbit IgG (b; green fluorescence) and a murine monoclonal antibody recognising the PV-located protein Exp1 followed by rhodamine-conjugated anti-mouse IgG (c; red fluorescence)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: K1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV
  • Other genes localised in this publication: sec31p, endoplasmic reticulum-resident calcium binding protein, small GTP-binding protein sar1, erythrocyte membrane protein 3

Bruce, M. C., Carter, R. N., Nakamura, K., Aikawa, M., Carter, R.
Cellular location and temporal expression of the Plasmodium falciparum sexual stage antigen Pfs16. (1994 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

gametocyte attached erythrocytic vesicle and intracellular and parasitophorous vacuole membrane during gametocyte
  • "By immunofluorescence assays on thin blood smears monoclonal antibodies specific for Pfs16 react strongly with the gametocyte and also with vesicles within the red blood cell cytoplasm, many of which connect with the gametocyte cell. Purification of parasitophorous vacuole membranes from mature and immature gametocytes and immunoelectron microscopy on gametocytes during gametogenesis have allowed us to locate Pfs16 to the parasitophorous vacuole membrane."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: intracellular and RBC vesicles connected to the gametocyte and PVM during gametocyte
  • Comment: no fulltext available online
  • Other genes localised in this publication: -

Simmons, D., Woollett, G., Bergin-Cartwright, M., Kay, D., Scaife, J.
A malaria protein exported into a new compartment within the host erythrocyte. (1987 Feb, EMBO J) PubMed / full text
   more detail about this publication

erythrocyte cytoplasmic structure during trophozoite
  • "A Plasmodium falciparum protein which is exported into a new compartment in the host erythrocyte has been located. This protein, exp-1, has a variable region recognized by a monoclonal antibody."
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody to exp-1 and CSP
  • Strain:
  • Gene model mapping comments: Blast from X05074, annotation matches
  • Localisation record: erythrocyte cytoplasmic structures during trophozoite
  • Comment: strain information not found
  • Comment: This is the original exp-1 paper.
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48217

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_091700 circumsporozoite-protein related antigen, putative
  • PCHAS_091760 circumsporozoite-related antigen
  • PKH_091900 circumsporozoite-related antigen, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF11_0224 circumsporozoite-related antigen
MKILSVFFLALFFIIFNKESLAEKTNKGTGSGVSSKKKNKKGSGEPLIDVHDLISDMIKKEEELVEVNKRKSKYKLATSV
LAGLLGVVSTVLLGGVGLVLYNTEKGRHPFKIGSSDPADNANPDADSESNGEPNAGPQVTAQDVTPEQPQGDDNNLVSGT
EH

Gene-Specific Links for PF11_0224

General Sub-Cellular Localisation Links