ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0192 (MYST)

histone acetyltransferase, putative, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and nucleus during ring and schizont
during not trophozoite

Who localised this protein by microscopy?

Miao, J., Fan, Q., Cui, L., Li, X., Wang, H., Ning, G., Reese, J. C., Cui, L.
The MYST family histone acetyltransferase regulates gene expression and cell cycle in malaria parasite Plasmodium falciparum. (2010 Nov, Mol Microbiol) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during ring and schizont, during not trophozoite
  • "Tagging PfMYST with the green fluorescent protein at the C-terminus showed that PfMYST protein was localized in both the nucleus and cytoplasm."
  • Microscopy type: Live light, Fixed light
  • Microscopy method: GFP tag, anitbody to epitope
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication, multiple splice sites were detected by RACE
  • Localisation record: nucleus and cytoplasm during ring and schizont, not during trophozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10222

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PF11_0192 histone acetyltransferase, putative
MVLGGKNENKVNVIKGAGSIGKYIMKENGSKIKEVGEWNNSSENENSDNNNNDREDNIKEKVDNNNKNDDNNNNDREDNI
KEKVDNNNNNDDNNNDNNNNNKSDNNNNKSDNNNNKSDNYNNKIGDVSNIPSTNTSTVSNKIQGKGSVSYKSKEKTGDHS
SNNKNTKGNNNKVRTSGKVINSLSKYSDSYALIFPNALPVKQVLWGLDPLNKVWRYCSIVYARPKNKVLNDTNFMFPLNM
NKNEIINKVNNELNNNNSVSMSEGDYDYYVHWEKFDRRLDCWLAYENLRLLDKEPDDGLPLIKDNDNVSDHEHAGIDKEY
LREHEENTKLKTINQIRFGKYLIDTWYFSPYPKEYQNIDILYICEFCLSFFKEYSELKRHIEKCEIRHPPGNEIYREEKI
SIFEIDGSYFRIYCENLCFLSKLFLDHKTLKHRVNLFLFYVITEYDEYGYHITGYFSKEKYSKNNVSCILTLPQHQKKGY
GKFLINFSYFLSQTEKRTGTPERPLSDLGVASYMAYWYETILKVLINYEQLSIQELSEITSIETNDIISCLEEKDIFKNS
LNGLDSFYYINPKQLEFILNKLKQTNNTQLSKNKLHWVSYDYYLALYE

Gene-Specific Links for PF11_0192

General Sub-Cellular Localisation Links