ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PF11_0190 ()

haloacid dehalogenase-like hydrolase, putative, a gene from Plasmodium falciparum

Compiled localisation
non-invasion-related localisation and not apical and not inner membrane complex and not merozoite surface during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

non-invasion-related localisation and not apical and not inner membrane complex and not merozoite surface during extracellular merozoite and late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22181

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_092970 haloacid dehalogenase-like hydrolase, putative
  • PY04231 o238, putative
  • PVX_091555 haloacid dehalogenase-like hydrolase, putative
  • PCHAS_091460 haloacid dehalogenase-like hydrolase, putative
  • PKH_091580 conserved Plasmodium protein, unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PF11_0190 haloacid dehalogenase-like hydrolase, putative
MKDEQISCYYLTEKGKNKCFKNIKLITFDLDHTIWNIDALLNYADNECYKYMEQNYKRLYDYLSKEYALSMTNLVKELLE
RNIDMNKDGVQILTRIRTDALKYLAKQTNYDEIKFASEIQKLWKEKKKDVHLFISPGTLEYLRELKNRGYILGAITNGDS
DVNEIKFLNEIFSFVVRSMDYNFAKPNVEIFNIAENLLKEKNINFHVDEWLHVGDDVYTDIMGAKNKNINCAWITMFREG
REISHKEWYSYLKLKYEQNDNKQTLSQYDPYADGLFAKFRKKDVVLPFDYIDIEIRHCRDLDSILA

Gene-Specific Links for PF11_0190

General Sub-Cellular Localisation Links